Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P7J6

Protein Details
Accession J3P7J6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-42LWKIPWRLSRFQKLRHRRRLRAVDSIVHydrophilic
76-105DKYTIFDRKEKKYRKGIHKLPKWTRVSQRVHydrophilic
NLS Segment(s)
PositionSequence
83-97RKEKKYRKGIHKLPK
Subcellular Location(s) mito 20, mito_nucl 13.333, nucl 4.5, cyto_nucl 4.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRITNPLNGGLLWKIPWRLSRFQKLRHRRRLRAVDSIVDTISQALSKKGETLKALDRWKAEMPREEEMLPKDKYTIFDRKEKKYRKGIHKLPKWTRVSQRVNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.18
4 0.16
5 0.16
6 0.18
7 0.24
8 0.28
9 0.36
10 0.43
11 0.52
12 0.56
13 0.64
14 0.72
15 0.77
16 0.83
17 0.85
18 0.87
19 0.84
20 0.88
21 0.88
22 0.82
23 0.8
24 0.72
25 0.65
26 0.57
27 0.5
28 0.4
29 0.29
30 0.24
31 0.15
32 0.12
33 0.09
34 0.06
35 0.06
36 0.07
37 0.07
38 0.09
39 0.1
40 0.12
41 0.12
42 0.15
43 0.19
44 0.25
45 0.28
46 0.28
47 0.27
48 0.28
49 0.31
50 0.33
51 0.3
52 0.3
53 0.32
54 0.31
55 0.33
56 0.3
57 0.29
58 0.27
59 0.3
60 0.25
61 0.21
62 0.21
63 0.2
64 0.23
65 0.26
66 0.32
67 0.3
68 0.39
69 0.46
70 0.54
71 0.63
72 0.69
73 0.71
74 0.73
75 0.79
76 0.81
77 0.85
78 0.85
79 0.86
80 0.86
81 0.89
82 0.88
83 0.88
84 0.83
85 0.8
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79