Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7ZRM8

Protein Details
Accession A0A2B7ZRM8    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-96AEFLKRKSCTQTKLRYPRVCTEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007918  MDM35_apoptosis  
Pfam View protein in Pfam  
PF05254  UPF0203  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSASLAPECNNIKEKYETCFLKWYSEKYLRGNTADKDCAKAFEEYQKCLSKTLKERGLDGMVEEARNSNKESDAEFLKRKSCTQTKLRYPRVCTEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.41
4 0.39
5 0.36
6 0.42
7 0.39
8 0.4
9 0.42
10 0.41
11 0.41
12 0.46
13 0.48
14 0.45
15 0.5
16 0.45
17 0.46
18 0.46
19 0.4
20 0.38
21 0.39
22 0.35
23 0.32
24 0.29
25 0.27
26 0.25
27 0.23
28 0.19
29 0.23
30 0.25
31 0.23
32 0.28
33 0.3
34 0.29
35 0.3
36 0.3
37 0.28
38 0.33
39 0.38
40 0.4
41 0.37
42 0.37
43 0.38
44 0.38
45 0.31
46 0.24
47 0.2
48 0.15
49 0.14
50 0.13
51 0.12
52 0.11
53 0.13
54 0.14
55 0.12
56 0.13
57 0.14
58 0.15
59 0.17
60 0.21
61 0.25
62 0.28
63 0.3
64 0.33
65 0.34
66 0.35
67 0.41
68 0.44
69 0.47
70 0.52
71 0.6
72 0.66
73 0.75
74 0.83
75 0.82
76 0.8