Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z728

Protein Details
Accession A0A2B7Z728    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-55EEEVEEKERRRRRRNRDRDRDMDMDAcidic
NLS Segment(s)
PositionSequence
37-46KERRRRRRNR
Subcellular Location(s) nucl 18, cyto 6.5, cyto_pero 4
Family & Domain DBs
Amino Acid Sequences MGGKDPEKQNGQSKVATEQAGLQGGGEDEGEEEVEEKERRRRRRNRDRDRDMDMDMDIRGFCKDGVMCQSAPVSTMPSPKVTCQKFAKKKLILYPPHAAERGHPLRVEASLAQQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.37
4 0.29
5 0.24
6 0.23
7 0.21
8 0.19
9 0.15
10 0.11
11 0.11
12 0.1
13 0.08
14 0.05
15 0.04
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.09
22 0.1
23 0.12
24 0.21
25 0.29
26 0.39
27 0.49
28 0.59
29 0.67
30 0.77
31 0.86
32 0.89
33 0.93
34 0.92
35 0.87
36 0.83
37 0.74
38 0.64
39 0.53
40 0.42
41 0.31
42 0.22
43 0.17
44 0.1
45 0.08
46 0.06
47 0.06
48 0.05
49 0.06
50 0.06
51 0.07
52 0.11
53 0.13
54 0.13
55 0.13
56 0.14
57 0.12
58 0.13
59 0.12
60 0.11
61 0.11
62 0.14
63 0.15
64 0.18
65 0.19
66 0.22
67 0.31
68 0.3
69 0.36
70 0.41
71 0.51
72 0.57
73 0.65
74 0.71
75 0.67
76 0.71
77 0.72
78 0.73
79 0.69
80 0.65
81 0.64
82 0.58
83 0.58
84 0.54
85 0.45
86 0.38
87 0.42
88 0.41
89 0.36
90 0.32
91 0.29
92 0.29
93 0.3
94 0.31
95 0.21