Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7ZMK4

Protein Details
Accession A0A2B7ZMK4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29GSLVPWIKSIHRRRQNKSKRLVIGHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MDCFGSLVPWIKSIHRRRQNKSKRLVIGHPTDFRRVEFTMPHYDKEDALSNETPSDSSALYHVSKREKLYHEAKMLKEKLSENTDVVRLRLLRHRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.56
3 0.65
4 0.71
5 0.81
6 0.87
7 0.86
8 0.86
9 0.84
10 0.82
11 0.78
12 0.75
13 0.71
14 0.68
15 0.64
16 0.61
17 0.54
18 0.51
19 0.46
20 0.39
21 0.36
22 0.29
23 0.25
24 0.21
25 0.23
26 0.29
27 0.29
28 0.3
29 0.28
30 0.28
31 0.26
32 0.26
33 0.27
34 0.17
35 0.19
36 0.19
37 0.17
38 0.16
39 0.16
40 0.14
41 0.1
42 0.1
43 0.07
44 0.06
45 0.06
46 0.09
47 0.1
48 0.12
49 0.15
50 0.19
51 0.23
52 0.26
53 0.32
54 0.33
55 0.39
56 0.43
57 0.47
58 0.49
59 0.52
60 0.52
61 0.54
62 0.53
63 0.48
64 0.46
65 0.41
66 0.4
67 0.39
68 0.39
69 0.31
70 0.32
71 0.35
72 0.32
73 0.3
74 0.29
75 0.25
76 0.27