Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7ZHR7

Protein Details
Accession A0A2B7ZHR7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
11-36SLILRNYTKLRRKPTPQRPRRITARTHydrophilic
NLS Segment(s)
PositionSequence
22-24RKP
Subcellular Location(s) nucl 11.5, cyto_nucl 9.5, mito 9, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGEYDMKADLSLILRNYTKLRRKPTPQRPRRITARTLVPGTVELRRRVELSLKVISVFGVEATVDYLELSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.23
4 0.3
5 0.38
6 0.42
7 0.5
8 0.55
9 0.65
10 0.74
11 0.8
12 0.83
13 0.83
14 0.87
15 0.85
16 0.83
17 0.82
18 0.77
19 0.69
20 0.62
21 0.59
22 0.52
23 0.46
24 0.39
25 0.3
26 0.26
27 0.24
28 0.24
29 0.21
30 0.2
31 0.21
32 0.22
33 0.23
34 0.23
35 0.26
36 0.25
37 0.27
38 0.27
39 0.25
40 0.25
41 0.24
42 0.22
43 0.17
44 0.13
45 0.08
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06