Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZDS9

Protein Details
Accession A0A2B7ZDS9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
189-217SGEELARPRKNRTKKRRRADRDRSVEPEVBasic
NLS Segment(s)
PositionSequence
194-209ARPRKNRTKKRRRADR
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR022793  Rrn10  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
Amino Acid Sequences MSRNARDDPPQAESPHDLLPRLRRQASVYDAVAGRVSSSGFRPQTLPHQTPAPSASSVPVTPEDVLFRRVNAPVRYAENDFYFANERLPSDQRLPDSEMLKAIHTYASDFYANATLDQGHADWQSMDETALIALGILLEEAANESLGETGDMVFVEGEEITDPEEPFTRSPSTSRGRKRVTVGSSSAISGEELARPRKNRTKKRRRADRDRSVEPEVALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.36
4 0.31
5 0.31
6 0.39
7 0.44
8 0.48
9 0.47
10 0.43
11 0.44
12 0.49
13 0.5
14 0.46
15 0.38
16 0.34
17 0.32
18 0.31
19 0.29
20 0.22
21 0.16
22 0.11
23 0.11
24 0.09
25 0.11
26 0.18
27 0.18
28 0.2
29 0.21
30 0.23
31 0.32
32 0.39
33 0.39
34 0.33
35 0.37
36 0.37
37 0.38
38 0.37
39 0.3
40 0.22
41 0.21
42 0.2
43 0.17
44 0.16
45 0.16
46 0.15
47 0.14
48 0.13
49 0.14
50 0.15
51 0.15
52 0.19
53 0.17
54 0.17
55 0.18
56 0.2
57 0.26
58 0.24
59 0.25
60 0.23
61 0.27
62 0.29
63 0.29
64 0.28
65 0.22
66 0.23
67 0.2
68 0.2
69 0.19
70 0.16
71 0.16
72 0.14
73 0.14
74 0.15
75 0.18
76 0.18
77 0.18
78 0.21
79 0.2
80 0.22
81 0.25
82 0.25
83 0.24
84 0.22
85 0.2
86 0.19
87 0.18
88 0.15
89 0.12
90 0.09
91 0.08
92 0.09
93 0.07
94 0.09
95 0.08
96 0.08
97 0.08
98 0.1
99 0.1
100 0.09
101 0.08
102 0.06
103 0.07
104 0.07
105 0.07
106 0.06
107 0.06
108 0.06
109 0.06
110 0.06
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.04
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.04
146 0.04
147 0.05
148 0.07
149 0.07
150 0.08
151 0.1
152 0.11
153 0.12
154 0.15
155 0.16
156 0.16
157 0.18
158 0.24
159 0.31
160 0.39
161 0.48
162 0.54
163 0.58
164 0.62
165 0.66
166 0.66
167 0.63
168 0.59
169 0.53
170 0.46
171 0.42
172 0.37
173 0.31
174 0.23
175 0.18
176 0.14
177 0.12
178 0.12
179 0.16
180 0.21
181 0.27
182 0.3
183 0.39
184 0.49
185 0.59
186 0.66
187 0.73
188 0.79
189 0.84
190 0.92
191 0.94
192 0.95
193 0.96
194 0.96
195 0.95
196 0.93
197 0.9
198 0.86
199 0.8
200 0.71