Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8R2D0

Protein Details
Accession J8R2D0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-85IAPKRESIRKRLKAKPIPVSTHydrophilic
NLS Segment(s)
PositionSequence
65-79IAPKRESIRKRLKAK
Subcellular Location(s) mito 23, extr 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences RMRILSRAISSTRLKNAKLFLLLFYFTTAIFNYLHKLKTRNKALKAFEADRTSSKPAIPALIKTIAPKRESIRKRLKAKPIPVSTPNLLSPFLLARRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.44
4 0.41
5 0.4
6 0.35
7 0.28
8 0.26
9 0.25
10 0.21
11 0.19
12 0.15
13 0.11
14 0.12
15 0.1
16 0.09
17 0.09
18 0.09
19 0.11
20 0.14
21 0.16
22 0.17
23 0.23
24 0.29
25 0.38
26 0.47
27 0.52
28 0.55
29 0.61
30 0.62
31 0.62
32 0.6
33 0.53
34 0.48
35 0.42
36 0.37
37 0.31
38 0.31
39 0.27
40 0.22
41 0.2
42 0.17
43 0.15
44 0.18
45 0.17
46 0.15
47 0.16
48 0.17
49 0.18
50 0.19
51 0.24
52 0.25
53 0.25
54 0.28
55 0.29
56 0.37
57 0.41
58 0.48
59 0.53
60 0.59
61 0.67
62 0.72
63 0.79
64 0.78
65 0.83
66 0.83
67 0.78
68 0.76
69 0.71
70 0.69
71 0.61
72 0.55
73 0.49
74 0.41
75 0.34
76 0.27
77 0.25
78 0.23
79 0.24