Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZUZ4

Protein Details
Accession A0A2B7ZUZ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
360-387MPTVTGRCPPRYNKRSRRPHPRQFNYRDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR005103  AA9  
Gene Ontology GO:0005576  C:extracellular region  
GO:0008810  F:cellulase activity  
GO:0030248  F:cellulose binding  
GO:0030245  P:cellulose catabolic process  
Pfam View protein in Pfam  
PF03443  AA9  
CDD cd21175  LPMO_AA9  
Amino Acid Sequences MSILKPAALVGALASVALVGAHGTVTGILADGNYFGGYLIGQYPYTANPPDVVGWSTTAIDNGYVDPSSYTSPNIICNRDAQPGAATAEVSAGGIIEVQWTEWPDSHHGPVLDYLANCNGDCSTVNKTTLEFFKIQEVGLVDGSQSPGKWASDELIANNNTWTLTIPKSIPSGNYVLRHEIIALHASHEDYGTQNYPQCFNLKITGGGTAQLQGTRGTDLYQSTDPGINLNIYNPLSGYEIPGPAVFDDSGNPGGDQDPDSSEPSAPAPSPPASPIVTPESPIVTPTVTPIDPPIDTPIVTPIVTPIVIPSPNETPSISYGAPATPTVLPSPNETPSISYGAVIPSPNETPSISDGAPAMPTVTGRCPPRYNKRSRRPHPRQFNYRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.04
4 0.04
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.04
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.08
28 0.08
29 0.09
30 0.1
31 0.11
32 0.15
33 0.16
34 0.15
35 0.14
36 0.16
37 0.16
38 0.17
39 0.17
40 0.14
41 0.14
42 0.14
43 0.15
44 0.13
45 0.13
46 0.11
47 0.1
48 0.1
49 0.09
50 0.1
51 0.09
52 0.09
53 0.09
54 0.1
55 0.12
56 0.13
57 0.13
58 0.13
59 0.14
60 0.22
61 0.26
62 0.27
63 0.26
64 0.3
65 0.32
66 0.34
67 0.34
68 0.27
69 0.23
70 0.22
71 0.22
72 0.18
73 0.15
74 0.1
75 0.1
76 0.09
77 0.08
78 0.05
79 0.04
80 0.04
81 0.04
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.07
88 0.08
89 0.09
90 0.12
91 0.16
92 0.19
93 0.2
94 0.22
95 0.2
96 0.2
97 0.2
98 0.2
99 0.18
100 0.15
101 0.15
102 0.15
103 0.16
104 0.14
105 0.14
106 0.12
107 0.1
108 0.11
109 0.12
110 0.15
111 0.17
112 0.18
113 0.18
114 0.19
115 0.21
116 0.23
117 0.24
118 0.19
119 0.17
120 0.2
121 0.2
122 0.2
123 0.18
124 0.16
125 0.14
126 0.13
127 0.12
128 0.08
129 0.08
130 0.09
131 0.08
132 0.07
133 0.07
134 0.08
135 0.08
136 0.09
137 0.08
138 0.09
139 0.12
140 0.12
141 0.12
142 0.16
143 0.17
144 0.17
145 0.16
146 0.15
147 0.12
148 0.11
149 0.11
150 0.08
151 0.08
152 0.1
153 0.11
154 0.12
155 0.14
156 0.14
157 0.14
158 0.14
159 0.17
160 0.18
161 0.21
162 0.2
163 0.21
164 0.2
165 0.2
166 0.17
167 0.14
168 0.12
169 0.11
170 0.09
171 0.08
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.06
178 0.07
179 0.07
180 0.08
181 0.1
182 0.11
183 0.12
184 0.13
185 0.14
186 0.14
187 0.14
188 0.15
189 0.14
190 0.14
191 0.13
192 0.14
193 0.13
194 0.12
195 0.11
196 0.1
197 0.09
198 0.09
199 0.09
200 0.07
201 0.08
202 0.08
203 0.08
204 0.07
205 0.08
206 0.08
207 0.11
208 0.11
209 0.11
210 0.12
211 0.13
212 0.12
213 0.11
214 0.12
215 0.09
216 0.09
217 0.09
218 0.11
219 0.1
220 0.1
221 0.09
222 0.1
223 0.1
224 0.1
225 0.12
226 0.1
227 0.1
228 0.11
229 0.11
230 0.1
231 0.08
232 0.1
233 0.08
234 0.07
235 0.07
236 0.09
237 0.1
238 0.1
239 0.1
240 0.09
241 0.09
242 0.1
243 0.11
244 0.09
245 0.11
246 0.12
247 0.14
248 0.15
249 0.14
250 0.14
251 0.14
252 0.15
253 0.12
254 0.11
255 0.13
256 0.13
257 0.14
258 0.14
259 0.16
260 0.16
261 0.16
262 0.18
263 0.21
264 0.2
265 0.21
266 0.2
267 0.2
268 0.19
269 0.19
270 0.17
271 0.11
272 0.1
273 0.11
274 0.14
275 0.11
276 0.12
277 0.13
278 0.15
279 0.14
280 0.16
281 0.18
282 0.15
283 0.16
284 0.16
285 0.17
286 0.16
287 0.16
288 0.15
289 0.11
290 0.12
291 0.12
292 0.11
293 0.1
294 0.12
295 0.12
296 0.13
297 0.15
298 0.17
299 0.19
300 0.2
301 0.19
302 0.18
303 0.19
304 0.23
305 0.2
306 0.17
307 0.17
308 0.16
309 0.17
310 0.15
311 0.15
312 0.12
313 0.13
314 0.15
315 0.18
316 0.18
317 0.22
318 0.26
319 0.26
320 0.27
321 0.26
322 0.26
323 0.25
324 0.28
325 0.23
326 0.19
327 0.18
328 0.17
329 0.18
330 0.17
331 0.15
332 0.14
333 0.16
334 0.16
335 0.16
336 0.15
337 0.16
338 0.19
339 0.22
340 0.18
341 0.18
342 0.18
343 0.18
344 0.18
345 0.15
346 0.12
347 0.09
348 0.1
349 0.12
350 0.15
351 0.2
352 0.25
353 0.31
354 0.38
355 0.47
356 0.58
357 0.66
358 0.73
359 0.78
360 0.84
361 0.89
362 0.92
363 0.94
364 0.94
365 0.95
366 0.95
367 0.95