Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Z5P4

Protein Details
Accession A0A2B7Z5P4    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
190-212QDLVRKPIRQRVRRTCHRCQTLFHydrophilic
220-244GDCEHIRCKKCPRDPPKLKKYPDGYBasic
249-276EPPFEPQERVWRKPRRRVRWTCHTCSNIHydrophilic
291-312RCTDCIRDPPKKIKPEPDPELLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 4, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011011  Znf_FYVE_PHD  
IPR013083  Znf_RING/FYVE/PHD  
Amino Acid Sequences MTEPTTPVKNGGEKDDGLGKYMKRVKTVLKGRNRASVSSMTDIIGESSKSGEKAAVTSSSSKPAATTVKKTMTSEPVQVHQWSTLQQEKARILFAKYGLTLEPGEWMSKPADRSVQRVEKPVRMRVRRNCHRCLTTFGADKVCAGCQHLRCTKCFRYPPAKPKDDDKDKAMAADIPKKVVLTIPSRTGGQDLVRKPIRQRVRRTCHRCQTLFIGDATVCGDCEHIRCKKCPRDPPKLKKYPDGYPGDVEPPFEPQERVWRKPRRRVRWTCHTCSNIFQSRDNICSNCQHERCTDCIRDPPKKIKPEPDPELLRRVESRLAKVSIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.35
4 0.32
5 0.33
6 0.28
7 0.33
8 0.4
9 0.4
10 0.35
11 0.39
12 0.44
13 0.5
14 0.6
15 0.6
16 0.63
17 0.7
18 0.7
19 0.75
20 0.7
21 0.61
22 0.56
23 0.53
24 0.46
25 0.41
26 0.38
27 0.29
28 0.27
29 0.25
30 0.22
31 0.17
32 0.12
33 0.09
34 0.1
35 0.11
36 0.11
37 0.12
38 0.12
39 0.11
40 0.12
41 0.14
42 0.15
43 0.15
44 0.2
45 0.21
46 0.25
47 0.25
48 0.24
49 0.22
50 0.23
51 0.3
52 0.3
53 0.35
54 0.36
55 0.42
56 0.44
57 0.46
58 0.46
59 0.45
60 0.43
61 0.43
62 0.38
63 0.35
64 0.36
65 0.34
66 0.31
67 0.25
68 0.23
69 0.19
70 0.22
71 0.25
72 0.25
73 0.26
74 0.3
75 0.31
76 0.31
77 0.32
78 0.29
79 0.24
80 0.25
81 0.24
82 0.21
83 0.18
84 0.18
85 0.15
86 0.16
87 0.14
88 0.11
89 0.12
90 0.1
91 0.11
92 0.1
93 0.11
94 0.11
95 0.13
96 0.14
97 0.14
98 0.21
99 0.21
100 0.26
101 0.33
102 0.4
103 0.39
104 0.46
105 0.48
106 0.48
107 0.5
108 0.54
109 0.55
110 0.54
111 0.61
112 0.63
113 0.7
114 0.74
115 0.77
116 0.76
117 0.73
118 0.7
119 0.62
120 0.6
121 0.55
122 0.49
123 0.46
124 0.41
125 0.36
126 0.31
127 0.3
128 0.24
129 0.18
130 0.13
131 0.12
132 0.15
133 0.16
134 0.23
135 0.28
136 0.29
137 0.3
138 0.38
139 0.4
140 0.43
141 0.45
142 0.45
143 0.49
144 0.56
145 0.64
146 0.66
147 0.65
148 0.59
149 0.61
150 0.64
151 0.63
152 0.57
153 0.5
154 0.44
155 0.4
156 0.39
157 0.33
158 0.25
159 0.19
160 0.23
161 0.2
162 0.17
163 0.17
164 0.17
165 0.17
166 0.16
167 0.17
168 0.14
169 0.16
170 0.18
171 0.19
172 0.19
173 0.19
174 0.19
175 0.17
176 0.16
177 0.2
178 0.19
179 0.26
180 0.28
181 0.3
182 0.31
183 0.38
184 0.45
185 0.46
186 0.56
187 0.59
188 0.66
189 0.76
190 0.82
191 0.84
192 0.84
193 0.84
194 0.75
195 0.67
196 0.63
197 0.57
198 0.5
199 0.4
200 0.31
201 0.23
202 0.22
203 0.19
204 0.13
205 0.08
206 0.07
207 0.07
208 0.06
209 0.09
210 0.15
211 0.21
212 0.24
213 0.3
214 0.39
215 0.48
216 0.57
217 0.65
218 0.68
219 0.73
220 0.81
221 0.87
222 0.88
223 0.88
224 0.83
225 0.81
226 0.77
227 0.73
228 0.71
229 0.67
230 0.58
231 0.51
232 0.49
233 0.44
234 0.39
235 0.33
236 0.24
237 0.22
238 0.22
239 0.21
240 0.2
241 0.17
242 0.28
243 0.34
244 0.4
245 0.46
246 0.54
247 0.62
248 0.72
249 0.82
250 0.82
251 0.86
252 0.9
253 0.9
254 0.9
255 0.9
256 0.87
257 0.85
258 0.79
259 0.7
260 0.65
261 0.64
262 0.61
263 0.54
264 0.5
265 0.47
266 0.46
267 0.48
268 0.47
269 0.4
270 0.34
271 0.39
272 0.41
273 0.44
274 0.43
275 0.41
276 0.43
277 0.45
278 0.48
279 0.48
280 0.47
281 0.41
282 0.49
283 0.55
284 0.59
285 0.63
286 0.68
287 0.69
288 0.75
289 0.78
290 0.79
291 0.8
292 0.81
293 0.8
294 0.79
295 0.78
296 0.72
297 0.72
298 0.63
299 0.57
300 0.49
301 0.46
302 0.45
303 0.41
304 0.43
305 0.43