Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z5C8

Protein Details
Accession A0A2B7Z5C8    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
156-176VEAERREKRREMKRLGERVDEBasic
NLS Segment(s)
PositionSequence
161-166REKRRE
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR037212  Med7/Med21-like  
IPR021384  Mediator_Med21  
Gene Ontology GO:0016592  C:mediator complex  
Pfam View protein in Pfam  
PF11221  Med21  
Amino Acid Sequences MADILTQLQTCLDQLATQFYATLCYLTTYHDHSAAIPPSNIPTAIPQLKKIPKNPPPATTSATTEKSAAGTAASPQPQQPRTPAAGEAQAQQQESQTEPTPDPPEIFALRQRELARDLIVKEQQIEYLISVLPGVGSSEAEQEERIRRLAEELRVVEAERREKRREMKRLGERVDELLEAVEGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.14
3 0.14
4 0.14
5 0.14
6 0.13
7 0.16
8 0.15
9 0.15
10 0.1
11 0.11
12 0.11
13 0.13
14 0.15
15 0.17
16 0.19
17 0.2
18 0.2
19 0.19
20 0.25
21 0.25
22 0.25
23 0.2
24 0.19
25 0.2
26 0.21
27 0.19
28 0.14
29 0.13
30 0.19
31 0.25
32 0.25
33 0.26
34 0.33
35 0.41
36 0.46
37 0.5
38 0.53
39 0.55
40 0.65
41 0.66
42 0.62
43 0.59
44 0.58
45 0.55
46 0.46
47 0.43
48 0.37
49 0.36
50 0.32
51 0.28
52 0.24
53 0.21
54 0.19
55 0.14
56 0.09
57 0.07
58 0.07
59 0.1
60 0.11
61 0.11
62 0.14
63 0.2
64 0.21
65 0.22
66 0.23
67 0.23
68 0.24
69 0.25
70 0.23
71 0.19
72 0.2
73 0.19
74 0.18
75 0.17
76 0.16
77 0.15
78 0.14
79 0.13
80 0.11
81 0.11
82 0.12
83 0.1
84 0.11
85 0.11
86 0.14
87 0.16
88 0.16
89 0.15
90 0.14
91 0.15
92 0.15
93 0.15
94 0.17
95 0.18
96 0.19
97 0.23
98 0.23
99 0.22
100 0.23
101 0.23
102 0.21
103 0.19
104 0.19
105 0.19
106 0.21
107 0.19
108 0.18
109 0.17
110 0.16
111 0.15
112 0.14
113 0.1
114 0.09
115 0.09
116 0.07
117 0.07
118 0.06
119 0.05
120 0.04
121 0.05
122 0.04
123 0.04
124 0.05
125 0.07
126 0.08
127 0.08
128 0.09
129 0.12
130 0.17
131 0.18
132 0.18
133 0.17
134 0.17
135 0.22
136 0.26
137 0.27
138 0.29
139 0.28
140 0.3
141 0.29
142 0.3
143 0.29
144 0.29
145 0.34
146 0.36
147 0.42
148 0.44
149 0.51
150 0.6
151 0.66
152 0.72
153 0.72
154 0.74
155 0.78
156 0.83
157 0.81
158 0.77
159 0.69
160 0.62
161 0.54
162 0.44
163 0.33
164 0.24
165 0.19