Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2B7Z0H0

Protein Details
Accession A0A2B7Z0H0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-78RTVRDCLRYKKKVIKRWKSSQQAVAKLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MENLTSTDVKTYFDYLERTHNGSIKAASALNDYWRALKSVHCEKTDNKLDERTVRDCLRYKKKVIKRWKSSQQAVAKLATVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.27
4 0.27
5 0.29
6 0.29
7 0.31
8 0.29
9 0.28
10 0.27
11 0.2
12 0.19
13 0.16
14 0.14
15 0.13
16 0.12
17 0.13
18 0.14
19 0.13
20 0.13
21 0.13
22 0.14
23 0.12
24 0.14
25 0.18
26 0.26
27 0.3
28 0.3
29 0.32
30 0.33
31 0.41
32 0.48
33 0.44
34 0.37
35 0.35
36 0.36
37 0.39
38 0.42
39 0.36
40 0.33
41 0.32
42 0.35
43 0.38
44 0.46
45 0.51
46 0.52
47 0.57
48 0.61
49 0.69
50 0.74
51 0.79
52 0.81
53 0.8
54 0.85
55 0.88
56 0.87
57 0.85
58 0.85
59 0.82
60 0.78
61 0.71
62 0.62