Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NZY9

Protein Details
Accession J3NZY9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-120LTPISTKIKSQKKRPWKRGDVVRRGLHydrophilic
NLS Segment(s)
PositionSequence
103-112KSQKKRPWKR
Subcellular Location(s) cyto 13, nucl 3, mito 3, extr 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MVLGQRDDNAIPIPAVFIFVPGMPVVVNQNTHQGLKVVNGAAYTALDVILDKAHPGHRVSADTILHFGPPAGIMLASETTRDLHFVGMPAGTVLLTPISTKIKSQKKRPWKRGDVVRRGLPCVAAFACTDYKMQSRILDRAALELRGTRTTTVNGEAVPSQCDPYSLYVQLSRCKTLDGITLLSKARERDFVGNTVPEEMSQAEQAELWGWPEEGFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.1
4 0.09
5 0.09
6 0.09
7 0.1
8 0.09
9 0.09
10 0.07
11 0.08
12 0.1
13 0.12
14 0.14
15 0.13
16 0.2
17 0.22
18 0.22
19 0.22
20 0.2
21 0.18
22 0.18
23 0.21
24 0.15
25 0.14
26 0.13
27 0.13
28 0.12
29 0.12
30 0.1
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.05
39 0.07
40 0.1
41 0.13
42 0.14
43 0.17
44 0.18
45 0.21
46 0.22
47 0.25
48 0.24
49 0.21
50 0.22
51 0.18
52 0.16
53 0.14
54 0.12
55 0.07
56 0.06
57 0.06
58 0.05
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.07
70 0.07
71 0.07
72 0.08
73 0.08
74 0.07
75 0.07
76 0.06
77 0.05
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.05
85 0.08
86 0.08
87 0.1
88 0.18
89 0.28
90 0.35
91 0.44
92 0.52
93 0.61
94 0.72
95 0.81
96 0.83
97 0.81
98 0.83
99 0.83
100 0.84
101 0.82
102 0.76
103 0.71
104 0.62
105 0.55
106 0.48
107 0.38
108 0.27
109 0.2
110 0.15
111 0.11
112 0.1
113 0.1
114 0.11
115 0.11
116 0.11
117 0.11
118 0.12
119 0.13
120 0.14
121 0.15
122 0.17
123 0.19
124 0.2
125 0.21
126 0.19
127 0.22
128 0.22
129 0.19
130 0.16
131 0.16
132 0.17
133 0.16
134 0.17
135 0.14
136 0.14
137 0.16
138 0.17
139 0.17
140 0.16
141 0.14
142 0.15
143 0.15
144 0.15
145 0.15
146 0.14
147 0.13
148 0.12
149 0.13
150 0.13
151 0.15
152 0.18
153 0.17
154 0.18
155 0.2
156 0.23
157 0.29
158 0.31
159 0.3
160 0.26
161 0.26
162 0.26
163 0.23
164 0.26
165 0.22
166 0.22
167 0.21
168 0.24
169 0.24
170 0.25
171 0.26
172 0.23
173 0.22
174 0.24
175 0.26
176 0.29
177 0.32
178 0.33
179 0.35
180 0.34
181 0.33
182 0.31
183 0.28
184 0.21
185 0.19
186 0.17
187 0.15
188 0.14
189 0.14
190 0.11
191 0.11
192 0.12
193 0.11
194 0.1
195 0.1
196 0.1
197 0.1