Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZH43

Protein Details
Accession A0A2B7ZH43   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKRHARYCKKGQTKTTRHIQRKHASPYTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8, cyto 6
Family & Domain DBs
Amino Acid Sequences MKRHARYCKKGQTKTTRHIQRKHASPYTGRDPASGFEVILDCENYTAEEACSPKEAVTTYGAAIQASRVNDRAARICLGDVHRAAGWPEPANKAYMEYKRRLCKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.85
4 0.83
5 0.83
6 0.82
7 0.8
8 0.8
9 0.81
10 0.76
11 0.7
12 0.65
13 0.64
14 0.61
15 0.57
16 0.49
17 0.4
18 0.35
19 0.32
20 0.31
21 0.24
22 0.16
23 0.11
24 0.11
25 0.11
26 0.1
27 0.1
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.07
37 0.07
38 0.09
39 0.09
40 0.08
41 0.09
42 0.09
43 0.09
44 0.1
45 0.1
46 0.09
47 0.11
48 0.11
49 0.1
50 0.09
51 0.09
52 0.1
53 0.1
54 0.11
55 0.1
56 0.11
57 0.13
58 0.15
59 0.18
60 0.17
61 0.17
62 0.16
63 0.16
64 0.19
65 0.2
66 0.23
67 0.2
68 0.2
69 0.19
70 0.19
71 0.19
72 0.18
73 0.19
74 0.18
75 0.21
76 0.23
77 0.24
78 0.24
79 0.24
80 0.24
81 0.29
82 0.35
83 0.38
84 0.42
85 0.5