Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZHF8

Protein Details
Accession A0A2B7ZHF8   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36AVEPPKFKQKKAKTRLTREQRDIRADHydrophilic
NLS Segment(s)
PositionSequence
5-25KKKSAGAVEPPKFKQKKAKTR
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPPIKKKSAGAVEPPKFKQKKAKTRLTREQRDIRADQLADLLDDDMPGFNMTGGSNLSGRGKSRLNKKKPMYIAYSKPSLPSKARLYFNTEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.6
4 0.59
5 0.6
6 0.6
7 0.64
8 0.67
9 0.75
10 0.75
11 0.83
12 0.9
13 0.9
14 0.88
15 0.86
16 0.85
17 0.8
18 0.76
19 0.67
20 0.58
21 0.51
22 0.42
23 0.33
24 0.25
25 0.2
26 0.13
27 0.12
28 0.1
29 0.06
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.06
43 0.07
44 0.08
45 0.09
46 0.1
47 0.13
48 0.18
49 0.23
50 0.34
51 0.44
52 0.5
53 0.6
54 0.64
55 0.69
56 0.7
57 0.7
58 0.67
59 0.65
60 0.64
61 0.59
62 0.58
63 0.5
64 0.48
65 0.47
66 0.44
67 0.4
68 0.4
69 0.44
70 0.47
71 0.52
72 0.5
73 0.56