Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7ZBW2

Protein Details
Accession A0A2B7ZBW2    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
56-81KGKGKAGKTRKAKGRRETRGKRKADDBasic
119-148QGLKRQKMAKKEPKESSRKRKKFLTKQLATHydrophilic
NLS Segment(s)
PositionSequence
28-78RKVRRDAAAAERARNQEIIGKGKGKGKGKGKGKAGKTRKAKGRRETRGKRK
122-141KRQKMAKKEPKESSRKRKKF
Subcellular Location(s) mito 9, nucl 8.5, cyto_nucl 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGSRCRGERARPLKRLLDALNDDDLKVRKVRRDAAAAERARNQEIIGKGKGKGKGKGKGKAGKTRKAKGRRETRGKRKADDAAGGQDDAWDPWELNVSSTEWFNAKDELQPPMVEAGGQGLKRQKMAKKEPKESSRKRKKFLTKQLATALRWQPSVRIPRHKRLDLSLTLRRNQTLGKPGCYPSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.66
3 0.58
4 0.55
5 0.49
6 0.45
7 0.45
8 0.39
9 0.36
10 0.34
11 0.33
12 0.27
13 0.28
14 0.28
15 0.29
16 0.34
17 0.41
18 0.42
19 0.47
20 0.49
21 0.52
22 0.58
23 0.54
24 0.51
25 0.5
26 0.47
27 0.42
28 0.38
29 0.29
30 0.25
31 0.27
32 0.29
33 0.27
34 0.27
35 0.28
36 0.33
37 0.39
38 0.38
39 0.42
40 0.45
41 0.5
42 0.56
43 0.6
44 0.64
45 0.66
46 0.68
47 0.71
48 0.71
49 0.71
50 0.71
51 0.73
52 0.74
53 0.76
54 0.78
55 0.77
56 0.8
57 0.82
58 0.84
59 0.87
60 0.88
61 0.88
62 0.83
63 0.75
64 0.69
65 0.64
66 0.55
67 0.47
68 0.38
69 0.31
70 0.28
71 0.25
72 0.2
73 0.15
74 0.12
75 0.09
76 0.09
77 0.06
78 0.05
79 0.05
80 0.08
81 0.07
82 0.08
83 0.09
84 0.08
85 0.09
86 0.09
87 0.1
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.12
94 0.13
95 0.15
96 0.15
97 0.14
98 0.14
99 0.13
100 0.12
101 0.09
102 0.07
103 0.08
104 0.1
105 0.1
106 0.11
107 0.15
108 0.16
109 0.19
110 0.24
111 0.26
112 0.33
113 0.44
114 0.52
115 0.58
116 0.66
117 0.73
118 0.77
119 0.84
120 0.85
121 0.85
122 0.86
123 0.85
124 0.82
125 0.83
126 0.85
127 0.85
128 0.86
129 0.86
130 0.79
131 0.76
132 0.79
133 0.74
134 0.64
135 0.62
136 0.56
137 0.48
138 0.45
139 0.4
140 0.34
141 0.36
142 0.44
143 0.43
144 0.49
145 0.53
146 0.62
147 0.71
148 0.74
149 0.69
150 0.67
151 0.67
152 0.64
153 0.64
154 0.63
155 0.59
156 0.58
157 0.57
158 0.51
159 0.46
160 0.41
161 0.4
162 0.42
163 0.41
164 0.41
165 0.43