Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3P366

Protein Details
Accession J3P366   
Localization Confidence Low
Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-24AQTPEQRRRNAKFQKDQEARRGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 6.5, cyto_nucl 4.5, plas 3, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAQTPEQRRRNAKFQKDQEARRGKSETDIKQRASKELNHKSPISPIWLGLLGFVVFGGLVFEVFSRFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.82
4 0.81
5 0.8
6 0.8
7 0.71
8 0.66
9 0.6
10 0.49
11 0.48
12 0.51
13 0.48
14 0.48
15 0.51
16 0.48
17 0.51
18 0.51
19 0.47
20 0.42
21 0.4
22 0.4
23 0.44
24 0.48
25 0.46
26 0.47
27 0.44
28 0.44
29 0.4
30 0.34
31 0.25
32 0.19
33 0.17
34 0.17
35 0.16
36 0.13
37 0.13
38 0.08
39 0.07
40 0.07
41 0.05
42 0.03
43 0.03
44 0.04
45 0.03
46 0.03
47 0.03
48 0.04
49 0.05