Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8TZH2

Protein Details
Accession J8TZH2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-78PESCAPVRGKRNKKGDWMLTHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MASAHGQWGSLAAVSARPEEGVVVNVPVAESLPPGRGTFACIPGIQEIILSPGWTWPSPESCAPVRGKRNKKGDWMLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.09
5 0.09
6 0.09
7 0.1
8 0.09
9 0.08
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.04
17 0.05
18 0.05
19 0.07
20 0.08
21 0.08
22 0.09
23 0.09
24 0.13
25 0.14
26 0.16
27 0.15
28 0.14
29 0.15
30 0.14
31 0.15
32 0.1
33 0.08
34 0.06
35 0.07
36 0.07
37 0.06
38 0.06
39 0.07
40 0.09
41 0.1
42 0.12
43 0.12
44 0.15
45 0.18
46 0.19
47 0.22
48 0.22
49 0.29
50 0.33
51 0.39
52 0.46
53 0.53
54 0.62
55 0.67
56 0.75
57 0.75
58 0.79