Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3AG35

Protein Details
Accession G3AG35   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
34-62VVKEEKEQPANKKRKQNTKFKETKKLKMEHydrophilic
NLS Segment(s)
PositionSequence
44-57NKKRKQNTKFKETK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
KEGG spaa:SPAPADRAFT_131035  -  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MAHPTADDLDDGLEYDLQLSDSEEETFVVEQPEVVKEEKEQPANKKRKQNTKFKETKKLKMEMDIETKKNMSVEESPEVIAEYINSKIRRKNPNLSALELADLYFAKSEIRSNVDFKETRNLDNLSAFITNRFKNMLPTKKGKEDSERKFIAIVSMSAIRACDIHRATRELSGSSLKLINKNKLNVDLKLVKSTRSRVLCCTPGRLAKVLAHEDSELQASEVKIIIVDNSYLDSKKQNIWDIPETFDVLKSLTKQGSKIYLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.08
4 0.08
5 0.08
6 0.08
7 0.09
8 0.1
9 0.11
10 0.11
11 0.1
12 0.11
13 0.12
14 0.11
15 0.11
16 0.1
17 0.09
18 0.1
19 0.12
20 0.13
21 0.14
22 0.13
23 0.15
24 0.23
25 0.29
26 0.35
27 0.39
28 0.47
29 0.56
30 0.66
31 0.71
32 0.73
33 0.76
34 0.8
35 0.83
36 0.85
37 0.84
38 0.84
39 0.87
40 0.85
41 0.87
42 0.83
43 0.84
44 0.8
45 0.78
46 0.68
47 0.66
48 0.61
49 0.56
50 0.58
51 0.54
52 0.48
53 0.43
54 0.42
55 0.34
56 0.32
57 0.26
58 0.2
59 0.17
60 0.2
61 0.21
62 0.21
63 0.21
64 0.2
65 0.2
66 0.16
67 0.12
68 0.08
69 0.07
70 0.09
71 0.14
72 0.16
73 0.19
74 0.25
75 0.33
76 0.43
77 0.48
78 0.55
79 0.57
80 0.65
81 0.65
82 0.61
83 0.55
84 0.45
85 0.39
86 0.29
87 0.22
88 0.13
89 0.1
90 0.07
91 0.05
92 0.05
93 0.05
94 0.05
95 0.07
96 0.08
97 0.12
98 0.13
99 0.15
100 0.16
101 0.21
102 0.22
103 0.21
104 0.28
105 0.26
106 0.25
107 0.27
108 0.27
109 0.22
110 0.22
111 0.21
112 0.13
113 0.13
114 0.12
115 0.11
116 0.13
117 0.13
118 0.13
119 0.15
120 0.13
121 0.19
122 0.27
123 0.33
124 0.34
125 0.41
126 0.44
127 0.49
128 0.52
129 0.48
130 0.5
131 0.52
132 0.53
133 0.54
134 0.51
135 0.44
136 0.42
137 0.39
138 0.31
139 0.22
140 0.16
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.08
147 0.08
148 0.08
149 0.12
150 0.13
151 0.16
152 0.18
153 0.21
154 0.22
155 0.25
156 0.25
157 0.2
158 0.2
159 0.19
160 0.17
161 0.16
162 0.19
163 0.17
164 0.23
165 0.27
166 0.33
167 0.35
168 0.39
169 0.39
170 0.44
171 0.46
172 0.4
173 0.42
174 0.42
175 0.38
176 0.42
177 0.41
178 0.36
179 0.37
180 0.4
181 0.41
182 0.4
183 0.41
184 0.39
185 0.45
186 0.49
187 0.47
188 0.48
189 0.45
190 0.44
191 0.45
192 0.41
193 0.37
194 0.33
195 0.36
196 0.35
197 0.31
198 0.27
199 0.25
200 0.23
201 0.22
202 0.2
203 0.14
204 0.11
205 0.12
206 0.1
207 0.11
208 0.11
209 0.09
210 0.08
211 0.08
212 0.09
213 0.07
214 0.08
215 0.07
216 0.09
217 0.11
218 0.12
219 0.13
220 0.16
221 0.18
222 0.23
223 0.28
224 0.33
225 0.35
226 0.42
227 0.48
228 0.46
229 0.47
230 0.43
231 0.4
232 0.34
233 0.31
234 0.24
235 0.18
236 0.19
237 0.18
238 0.22
239 0.25
240 0.27
241 0.28
242 0.32