Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AES6

Protein Details
Accession G3AES6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
169-188LQGDGGKKAKKKRGLFGRKKBasic
NLS Segment(s)
PositionSequence
174-188GKKAKKKRGLFGRKK
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018809  DUF2406  
KEGG spaa:SPAPADRAFT_58941  -  
Pfam View protein in Pfam  
PF10295  DUF2406  
Amino Acid Sequences MAIFRGKSAKKAPTKAGQIDVKISSKDAQQFKMHTANVHDPILKAVNEDQPFEQAARHDNRRPSYLSQDSGNLKDIFGNPIRQADMSNPTRERNERPLDTIRGFEYAITGDVGYRDQLESHRLGWGFHEDFPYYNLASGNQQRSNEFSRPVINFDQPVYQTGNYSASSLQGDGGKKAKKKRGLFGRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.68
4 0.64
5 0.57
6 0.54
7 0.51
8 0.45
9 0.37
10 0.34
11 0.28
12 0.27
13 0.33
14 0.33
15 0.34
16 0.36
17 0.37
18 0.4
19 0.45
20 0.41
21 0.36
22 0.37
23 0.39
24 0.38
25 0.38
26 0.34
27 0.27
28 0.29
29 0.29
30 0.23
31 0.18
32 0.18
33 0.23
34 0.23
35 0.24
36 0.22
37 0.21
38 0.22
39 0.2
40 0.18
41 0.12
42 0.18
43 0.22
44 0.28
45 0.32
46 0.37
47 0.4
48 0.42
49 0.45
50 0.41
51 0.44
52 0.42
53 0.38
54 0.33
55 0.35
56 0.35
57 0.32
58 0.33
59 0.25
60 0.2
61 0.2
62 0.2
63 0.18
64 0.18
65 0.18
66 0.15
67 0.16
68 0.16
69 0.15
70 0.14
71 0.13
72 0.19
73 0.19
74 0.23
75 0.23
76 0.24
77 0.27
78 0.29
79 0.31
80 0.32
81 0.35
82 0.32
83 0.35
84 0.37
85 0.38
86 0.37
87 0.33
88 0.26
89 0.21
90 0.2
91 0.16
92 0.12
93 0.08
94 0.08
95 0.07
96 0.06
97 0.05
98 0.05
99 0.06
100 0.05
101 0.05
102 0.05
103 0.06
104 0.07
105 0.1
106 0.11
107 0.11
108 0.14
109 0.14
110 0.14
111 0.15
112 0.2
113 0.19
114 0.19
115 0.2
116 0.18
117 0.18
118 0.19
119 0.2
120 0.13
121 0.13
122 0.12
123 0.11
124 0.16
125 0.21
126 0.26
127 0.28
128 0.29
129 0.29
130 0.33
131 0.38
132 0.36
133 0.32
134 0.28
135 0.3
136 0.31
137 0.35
138 0.34
139 0.31
140 0.29
141 0.28
142 0.31
143 0.25
144 0.26
145 0.25
146 0.22
147 0.2
148 0.2
149 0.22
150 0.18
151 0.18
152 0.16
153 0.14
154 0.15
155 0.14
156 0.14
157 0.16
158 0.17
159 0.19
160 0.26
161 0.31
162 0.36
163 0.45
164 0.53
165 0.58
166 0.64
167 0.71
168 0.75