Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJT6

Protein Details
Accession J3PJT6   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-58AVLVKRLSPSPSKKPRRKSRPRRCGPHPKSNATGHydrophilic
NLS Segment(s)
PositionSequence
32-47SPSPSKKPRRKSRPRR
312-316RWKKK
Subcellular Location(s) nucl 12, cyto 11, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002711  HNH  
IPR003615  HNH_nuc  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF01844  HNH  
CDD cd00085  HNHc  
Amino Acid Sequences MVAELKQTDPEGTANLELFRDCLSAVLVKRLSPSPSKKPRRKSRPRRCGPHPKSNATGCHARSPEESVGAGSGAPLFGRILKPSAAAILPVTDGDTRDGDGADAATAAEELGEFIDYIAASSFAALPEDLRSLSHRGWAEDQALSSRYPLPLTGGSLPNVLPCALDPHVVDSLQAYGVLPSSSLSSSLSPSSTSAAEDLLAPVLNDYIEAATAPPPPRVARGAAEACEMCGRGWINLSYHHLIPRMVHDKAVRRGWHREDELQNVAWLCGACHRAVHRFARHEDLARHYYTVERLLAQDELAAFARWVGRLRWKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.14
5 0.14
6 0.13
7 0.12
8 0.1
9 0.09
10 0.1
11 0.14
12 0.15
13 0.22
14 0.22
15 0.22
16 0.25
17 0.28
18 0.31
19 0.35
20 0.42
21 0.46
22 0.56
23 0.66
24 0.73
25 0.8
26 0.88
27 0.9
28 0.93
29 0.94
30 0.94
31 0.95
32 0.96
33 0.95
34 0.94
35 0.94
36 0.92
37 0.91
38 0.89
39 0.84
40 0.8
41 0.76
42 0.7
43 0.63
44 0.62
45 0.53
46 0.53
47 0.47
48 0.43
49 0.38
50 0.39
51 0.36
52 0.29
53 0.27
54 0.19
55 0.19
56 0.16
57 0.14
58 0.08
59 0.07
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.08
66 0.09
67 0.11
68 0.11
69 0.12
70 0.12
71 0.13
72 0.11
73 0.11
74 0.1
75 0.08
76 0.08
77 0.07
78 0.09
79 0.07
80 0.08
81 0.09
82 0.09
83 0.09
84 0.09
85 0.09
86 0.08
87 0.08
88 0.07
89 0.05
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.02
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.05
112 0.04
113 0.05
114 0.05
115 0.06
116 0.06
117 0.06
118 0.09
119 0.11
120 0.12
121 0.16
122 0.16
123 0.17
124 0.19
125 0.2
126 0.2
127 0.17
128 0.17
129 0.14
130 0.14
131 0.13
132 0.12
133 0.11
134 0.1
135 0.09
136 0.09
137 0.1
138 0.09
139 0.11
140 0.13
141 0.13
142 0.13
143 0.13
144 0.13
145 0.11
146 0.11
147 0.09
148 0.06
149 0.05
150 0.08
151 0.08
152 0.09
153 0.09
154 0.11
155 0.12
156 0.12
157 0.12
158 0.08
159 0.08
160 0.07
161 0.07
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.05
169 0.05
170 0.05
171 0.06
172 0.07
173 0.08
174 0.09
175 0.09
176 0.09
177 0.09
178 0.1
179 0.09
180 0.09
181 0.08
182 0.08
183 0.07
184 0.07
185 0.07
186 0.06
187 0.05
188 0.05
189 0.05
190 0.05
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.04
197 0.04
198 0.05
199 0.1
200 0.12
201 0.12
202 0.14
203 0.15
204 0.17
205 0.19
206 0.2
207 0.17
208 0.22
209 0.24
210 0.23
211 0.24
212 0.22
213 0.2
214 0.19
215 0.18
216 0.11
217 0.12
218 0.12
219 0.1
220 0.12
221 0.13
222 0.13
223 0.16
224 0.22
225 0.22
226 0.23
227 0.24
228 0.24
229 0.23
230 0.23
231 0.28
232 0.28
233 0.25
234 0.27
235 0.3
236 0.37
237 0.44
238 0.5
239 0.47
240 0.47
241 0.55
242 0.58
243 0.61
244 0.58
245 0.59
246 0.56
247 0.57
248 0.55
249 0.48
250 0.43
251 0.35
252 0.3
253 0.23
254 0.18
255 0.13
256 0.14
257 0.15
258 0.13
259 0.16
260 0.2
261 0.24
262 0.31
263 0.39
264 0.42
265 0.47
266 0.5
267 0.55
268 0.55
269 0.54
270 0.52
271 0.51
272 0.48
273 0.43
274 0.4
275 0.33
276 0.33
277 0.3
278 0.29
279 0.23
280 0.2
281 0.2
282 0.21
283 0.21
284 0.18
285 0.17
286 0.13
287 0.14
288 0.14
289 0.13
290 0.11
291 0.12
292 0.14
293 0.14
294 0.16
295 0.18
296 0.27