Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V3S5

Protein Details
Accession A0A2D3V3S5    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
167-188APPPSRYRVGEPKQQSRRRHRKBasic
NLS Segment(s)
PositionSequence
180-189KQQSRRRHRK
Subcellular Location(s) plas 23, mito 1, extr 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039632  TMEM42  
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MSTQPKTQWLFYAIASGGCAALNGVFAKLTTTSLTTSWATGISHLFGLDEPSVIVEFLIRGFFFLMNLAFNAVMWGLFTRALTLASSTVRVSVINTSANFFLTALLGAVIFTESLPGLWWLGAVMLVIGSVIIGRREEPGKEXQVGGGTEPVVGGGSINLDYTDEPDAPPPSRYRVGEPKQQSRRRHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.13
5 0.1
6 0.1
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.08
15 0.08
16 0.09
17 0.09
18 0.1
19 0.11
20 0.11
21 0.15
22 0.14
23 0.14
24 0.13
25 0.13
26 0.12
27 0.12
28 0.12
29 0.1
30 0.09
31 0.09
32 0.09
33 0.08
34 0.1
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.05
57 0.05
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.08
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.1
87 0.08
88 0.07
89 0.05
90 0.05
91 0.04
92 0.04
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.04
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.04
120 0.04
121 0.05
122 0.08
123 0.1
124 0.11
125 0.15
126 0.2
127 0.21
128 0.22
129 0.21
130 0.2
131 0.21
132 0.2
133 0.16
134 0.12
135 0.09
136 0.08
137 0.08
138 0.07
139 0.05
140 0.04
141 0.04
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.08
149 0.11
150 0.1
151 0.11
152 0.14
153 0.18
154 0.19
155 0.22
156 0.23
157 0.27
158 0.33
159 0.35
160 0.39
161 0.47
162 0.52
163 0.58
164 0.65
165 0.69
166 0.74
167 0.8
168 0.83