Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3VQ66

Protein Details
Accession A0A2D3VQ66    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
214-237SLEERVKRLRERREKLRQVEHVTPBasic
NLS Segment(s)
PositionSequence
74-79GKKRKA
Subcellular Location(s) nucl 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040050  ZNF830-like  
IPR036236  Znf_C2H2_sf  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12874  zf-met  
Amino Acid Sequences MTDVRSMLRQSREARRITHPHASYTPDSKIRCNLCDTLVKSEAAWQSHLHSSQHTLRQTRAQEAAATRAGNGAGKKRKADSQNSPPPEDRKKAKSVTFVAGVEEPEDVVDPEEVLPSVNDSAPLVNPQPSSGNDEVVDPAEMAAFERELAEMEASMVSNAADKATISAPAMTAEEVAAQAREEQXMQRGNRDAELEAEREDAARMLEDELDEMESLEERVKRLRERREKLRQVEHVTPTIQAPAIRQENHANXGSEDEEDEEDVEEWAFGAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.61
3 0.65
4 0.65
5 0.68
6 0.59
7 0.57
8 0.57
9 0.58
10 0.53
11 0.49
12 0.49
13 0.46
14 0.46
15 0.43
16 0.48
17 0.47
18 0.45
19 0.45
20 0.41
21 0.38
22 0.44
23 0.43
24 0.42
25 0.4
26 0.37
27 0.32
28 0.36
29 0.36
30 0.29
31 0.28
32 0.22
33 0.23
34 0.28
35 0.3
36 0.25
37 0.22
38 0.26
39 0.32
40 0.38
41 0.4
42 0.37
43 0.38
44 0.44
45 0.46
46 0.45
47 0.4
48 0.34
49 0.32
50 0.31
51 0.33
52 0.28
53 0.25
54 0.2
55 0.18
56 0.17
57 0.16
58 0.17
59 0.21
60 0.27
61 0.3
62 0.32
63 0.34
64 0.41
65 0.45
66 0.52
67 0.53
68 0.56
69 0.63
70 0.64
71 0.66
72 0.62
73 0.62
74 0.6
75 0.57
76 0.53
77 0.49
78 0.52
79 0.53
80 0.54
81 0.54
82 0.51
83 0.48
84 0.45
85 0.39
86 0.33
87 0.28
88 0.25
89 0.18
90 0.14
91 0.1
92 0.07
93 0.07
94 0.05
95 0.05
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.04
103 0.05
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.08
111 0.08
112 0.09
113 0.09
114 0.1
115 0.11
116 0.12
117 0.17
118 0.16
119 0.16
120 0.15
121 0.15
122 0.15
123 0.13
124 0.12
125 0.06
126 0.06
127 0.05
128 0.04
129 0.04
130 0.04
131 0.03
132 0.03
133 0.04
134 0.04
135 0.04
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.06
151 0.06
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.08
158 0.06
159 0.06
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.04
166 0.05
167 0.05
168 0.08
169 0.08
170 0.1
171 0.16
172 0.21
173 0.23
174 0.26
175 0.26
176 0.24
177 0.26
178 0.25
179 0.22
180 0.19
181 0.19
182 0.16
183 0.15
184 0.15
185 0.13
186 0.13
187 0.1
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.07
196 0.08
197 0.07
198 0.07
199 0.06
200 0.06
201 0.07
202 0.1
203 0.1
204 0.11
205 0.16
206 0.21
207 0.29
208 0.37
209 0.48
210 0.56
211 0.64
212 0.74
213 0.8
214 0.85
215 0.85
216 0.86
217 0.84
218 0.81
219 0.8
220 0.73
221 0.66
222 0.57
223 0.49
224 0.4
225 0.33
226 0.27
227 0.2
228 0.17
229 0.22
230 0.27
231 0.28
232 0.3
233 0.35
234 0.38
235 0.4
236 0.42
237 0.36
238 0.3
239 0.33
240 0.32
241 0.26
242 0.23
243 0.2
244 0.17
245 0.15
246 0.15
247 0.11
248 0.1
249 0.1
250 0.08