Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3AQY1

Protein Details
Accession G3AQY1    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-174IEDKLRKIKLQKKMALKKGPBasic
NLS Segment(s)
PositionSequence
151-212KKKEIEDKLRKIKLQKKMALKKGPVHVQVQKFGKKSEVVPKSENKIIASRDKWLKRKSVNRK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013268  U3_snoRNA_assoc  
Gene Ontology GO:0030515  F:snoRNA binding  
GO:0006364  P:rRNA processing  
KEGG spaa:SPAPADRAFT_56102  -  
Pfam View protein in Pfam  
PF08297  U3_snoRNA_assoc  
Amino Acid Sequences MAVTRSQDKAKKIVFEDNEDEEESVEIEARQEEEDKEPESEEESESESESDDEAPEEESTNKTKQEVLAQQKKREQEQKAQKNAERERRRQLDLRNKQQQESKKATKIEEEALPDLLPDDIMDILSTPEPEETQSKIKGKHIRLDEVELDKKKEIEDKLRKIKLQKKMALKKGPVHVQVQKFGKKSEVVPKSENKIIASRDKWLKRKSVNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.54
4 0.49
5 0.47
6 0.42
7 0.38
8 0.29
9 0.25
10 0.19
11 0.14
12 0.1
13 0.07
14 0.07
15 0.08
16 0.08
17 0.09
18 0.1
19 0.12
20 0.16
21 0.18
22 0.19
23 0.2
24 0.19
25 0.19
26 0.2
27 0.19
28 0.16
29 0.15
30 0.15
31 0.15
32 0.15
33 0.14
34 0.12
35 0.11
36 0.1
37 0.1
38 0.07
39 0.07
40 0.07
41 0.09
42 0.08
43 0.09
44 0.09
45 0.11
46 0.15
47 0.16
48 0.17
49 0.16
50 0.17
51 0.18
52 0.24
53 0.31
54 0.37
55 0.45
56 0.5
57 0.55
58 0.58
59 0.61
60 0.6
61 0.6
62 0.54
63 0.54
64 0.6
65 0.64
66 0.68
67 0.7
68 0.66
69 0.67
70 0.7
71 0.71
72 0.68
73 0.64
74 0.65
75 0.64
76 0.65
77 0.61
78 0.63
79 0.63
80 0.65
81 0.69
82 0.69
83 0.66
84 0.64
85 0.64
86 0.62
87 0.58
88 0.56
89 0.52
90 0.47
91 0.48
92 0.47
93 0.44
94 0.39
95 0.34
96 0.28
97 0.24
98 0.2
99 0.18
100 0.17
101 0.14
102 0.12
103 0.09
104 0.06
105 0.04
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.07
118 0.08
119 0.1
120 0.14
121 0.19
122 0.23
123 0.26
124 0.33
125 0.4
126 0.41
127 0.46
128 0.46
129 0.47
130 0.45
131 0.46
132 0.43
133 0.41
134 0.44
135 0.39
136 0.38
137 0.33
138 0.31
139 0.28
140 0.3
141 0.28
142 0.32
143 0.4
144 0.48
145 0.57
146 0.62
147 0.64
148 0.68
149 0.72
150 0.71
151 0.71
152 0.69
153 0.69
154 0.74
155 0.8
156 0.8
157 0.77
158 0.74
159 0.72
160 0.73
161 0.65
162 0.62
163 0.6
164 0.55
165 0.58
166 0.59
167 0.57
168 0.51
169 0.49
170 0.46
171 0.41
172 0.42
173 0.45
174 0.45
175 0.44
176 0.48
177 0.53
178 0.56
179 0.57
180 0.54
181 0.47
182 0.45
183 0.44
184 0.48
185 0.43
186 0.46
187 0.51
188 0.58
189 0.64
190 0.65
191 0.69
192 0.7