Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QW31

Protein Details
Accession C4QW31   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-71EERQKEKPGRKRRSAGRRRHSTENFBasic
NLS Segment(s)
PositionSequence
49-65RQKEKPGRKRRSAGRRR
Subcellular Location(s) nucl 19, cyto_nucl 11.666, mito_nucl 11.666, cyto_mito 3.666, mito 3, cyto 3
Family & Domain DBs
KEGG ppa:PAS_chr1-1_0094  -  
Amino Acid Sequences MMSGFVHRLSCGLLDFPLPILGKRTFERNPDKKKVINRADLIELILEERQKEKPGRKRRSAGRRRHSTENFSRSSNSMNDDLVQKDPLSNQRTRDSLSPRTEVMFDDSNLSHPGVGYEQVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.14
5 0.13
6 0.13
7 0.16
8 0.18
9 0.2
10 0.21
11 0.28
12 0.27
13 0.36
14 0.46
15 0.51
16 0.59
17 0.65
18 0.68
19 0.67
20 0.71
21 0.74
22 0.71
23 0.68
24 0.61
25 0.55
26 0.52
27 0.47
28 0.39
29 0.28
30 0.2
31 0.13
32 0.11
33 0.09
34 0.07
35 0.09
36 0.1
37 0.14
38 0.19
39 0.27
40 0.36
41 0.47
42 0.55
43 0.61
44 0.68
45 0.73
46 0.8
47 0.81
48 0.82
49 0.81
50 0.82
51 0.8
52 0.82
53 0.76
54 0.72
55 0.71
56 0.67
57 0.59
58 0.5
59 0.46
60 0.37
61 0.36
62 0.29
63 0.24
64 0.18
65 0.17
66 0.17
67 0.17
68 0.18
69 0.16
70 0.16
71 0.13
72 0.12
73 0.15
74 0.22
75 0.25
76 0.27
77 0.3
78 0.33
79 0.35
80 0.37
81 0.41
82 0.4
83 0.44
84 0.46
85 0.44
86 0.4
87 0.4
88 0.38
89 0.33
90 0.31
91 0.25
92 0.21
93 0.22
94 0.21
95 0.22
96 0.23
97 0.22
98 0.17
99 0.14
100 0.15
101 0.12