Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3V020

Protein Details
Accession A0A2D3V020    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
355-376EEERLRREKAERKKKLLALSKSBasic
NLS Segment(s)
PositionSequence
192-235IKHKTVEKMTKREREKERERAQQAVKANGKPGAKAAKAGQLPDR
250-251KK
358-383RLRREKAERKKKLLALSKSAAAKKKY
Subcellular Location(s) mito 20.5, mito_nucl 13.5, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MTSFQSLLSSIGGGQPKAPQPKTSGATNSAPGTPGSTRPPIPPSTARPAATNLAAGVKRKPDDQPGPPQPKTVRTEVRVPVRPTSQGGAHPAAKPAPSITAAPKPTSSAMAQPTAYRGTARPSGSIQPAKPLSAPAPAPKPAAKQPTVTASTTTPTAPTADSSSKPKRGFAAIMAKAKAAEEVAKAAGSSMIKHKTVEKMTKREREKERERAQQAVKANGKPGAKAAKAGQLPDRSRSNTPNDVKPGLSKKAPEIAYKGTMKKPVKPVPEIAYRGTMRKSVPGEQAPKPVAKKGMAQDKYGGYASWSDLSGAEDEEEDYESDASSMMEAGLDDVEAEETMALRAAKREDQEAMEEEERLRREKAERKKKLLALSKSAAAKKKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.29
4 0.38
5 0.4
6 0.38
7 0.4
8 0.49
9 0.51
10 0.51
11 0.49
12 0.45
13 0.46
14 0.47
15 0.44
16 0.36
17 0.34
18 0.28
19 0.26
20 0.23
21 0.23
22 0.25
23 0.28
24 0.29
25 0.32
26 0.38
27 0.36
28 0.41
29 0.44
30 0.45
31 0.49
32 0.53
33 0.5
34 0.47
35 0.48
36 0.45
37 0.39
38 0.32
39 0.24
40 0.23
41 0.24
42 0.24
43 0.24
44 0.27
45 0.27
46 0.3
47 0.33
48 0.37
49 0.43
50 0.48
51 0.55
52 0.6
53 0.68
54 0.65
55 0.68
56 0.62
57 0.62
58 0.6
59 0.57
60 0.55
61 0.49
62 0.57
63 0.58
64 0.64
65 0.63
66 0.62
67 0.58
68 0.53
69 0.51
70 0.45
71 0.41
72 0.34
73 0.29
74 0.31
75 0.31
76 0.31
77 0.29
78 0.29
79 0.28
80 0.25
81 0.23
82 0.18
83 0.16
84 0.15
85 0.16
86 0.18
87 0.23
88 0.25
89 0.26
90 0.26
91 0.26
92 0.25
93 0.26
94 0.22
95 0.2
96 0.21
97 0.22
98 0.22
99 0.21
100 0.22
101 0.21
102 0.2
103 0.16
104 0.14
105 0.16
106 0.21
107 0.22
108 0.21
109 0.23
110 0.27
111 0.32
112 0.36
113 0.31
114 0.33
115 0.33
116 0.32
117 0.3
118 0.27
119 0.22
120 0.21
121 0.22
122 0.19
123 0.22
124 0.23
125 0.25
126 0.25
127 0.28
128 0.3
129 0.36
130 0.33
131 0.31
132 0.31
133 0.35
134 0.36
135 0.33
136 0.28
137 0.22
138 0.21
139 0.2
140 0.19
141 0.13
142 0.1
143 0.1
144 0.09
145 0.09
146 0.12
147 0.13
148 0.15
149 0.22
150 0.28
151 0.34
152 0.35
153 0.35
154 0.33
155 0.33
156 0.32
157 0.3
158 0.33
159 0.31
160 0.34
161 0.33
162 0.31
163 0.29
164 0.28
165 0.22
166 0.13
167 0.09
168 0.06
169 0.06
170 0.07
171 0.06
172 0.06
173 0.06
174 0.07
175 0.06
176 0.07
177 0.11
178 0.13
179 0.14
180 0.15
181 0.17
182 0.21
183 0.26
184 0.34
185 0.36
186 0.43
187 0.51
188 0.59
189 0.62
190 0.65
191 0.69
192 0.7
193 0.72
194 0.73
195 0.73
196 0.74
197 0.71
198 0.69
199 0.63
200 0.58
201 0.52
202 0.5
203 0.46
204 0.37
205 0.37
206 0.34
207 0.32
208 0.27
209 0.28
210 0.25
211 0.21
212 0.22
213 0.22
214 0.24
215 0.25
216 0.26
217 0.28
218 0.3
219 0.31
220 0.34
221 0.36
222 0.33
223 0.36
224 0.39
225 0.4
226 0.41
227 0.44
228 0.45
229 0.46
230 0.44
231 0.41
232 0.42
233 0.41
234 0.36
235 0.34
236 0.29
237 0.27
238 0.33
239 0.35
240 0.31
241 0.3
242 0.29
243 0.33
244 0.36
245 0.38
246 0.34
247 0.41
248 0.41
249 0.44
250 0.5
251 0.51
252 0.53
253 0.52
254 0.54
255 0.51
256 0.57
257 0.53
258 0.45
259 0.44
260 0.4
261 0.39
262 0.36
263 0.33
264 0.25
265 0.29
266 0.3
267 0.29
268 0.35
269 0.39
270 0.44
271 0.44
272 0.5
273 0.46
274 0.47
275 0.43
276 0.4
277 0.37
278 0.33
279 0.36
280 0.36
281 0.45
282 0.43
283 0.43
284 0.43
285 0.4
286 0.4
287 0.35
288 0.27
289 0.18
290 0.17
291 0.17
292 0.14
293 0.13
294 0.11
295 0.11
296 0.12
297 0.12
298 0.11
299 0.09
300 0.08
301 0.08
302 0.09
303 0.09
304 0.08
305 0.08
306 0.08
307 0.08
308 0.07
309 0.07
310 0.06
311 0.06
312 0.05
313 0.04
314 0.04
315 0.04
316 0.05
317 0.05
318 0.04
319 0.04
320 0.04
321 0.05
322 0.05
323 0.05
324 0.04
325 0.05
326 0.05
327 0.07
328 0.07
329 0.08
330 0.11
331 0.15
332 0.19
333 0.21
334 0.24
335 0.25
336 0.27
337 0.3
338 0.3
339 0.33
340 0.29
341 0.29
342 0.27
343 0.29
344 0.3
345 0.29
346 0.27
347 0.25
348 0.33
349 0.42
350 0.52
351 0.57
352 0.66
353 0.71
354 0.79
355 0.81
356 0.82
357 0.83
358 0.79
359 0.77
360 0.71
361 0.68
362 0.66
363 0.66