Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V1A8

Protein Details
Accession A0A2D3V1A8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-104QDSRFSRGSRGSRRGRDRREVHFEBasic
NLS Segment(s)
PositionSequence
89-97SRGSRRGRD
Subcellular Location(s) extr 17, cyto 5.5, cyto_nucl 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000612  PMP3  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01679  Pmp3  
PROSITE View protein in PROSITE  
PS01309  UPF0057  
Amino Acid Sequences MSSATIIQIILAILLPPVAVFTTDGCGAQLIINVVLFACFIFPAVIHALYLVWVDKKHKERVYVVEYDVRSDGSGDRRGSQDSRFSRGSRGSRRGRDRREVHFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.08
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.08
16 0.09
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.04
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.05
31 0.06
32 0.06
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.05
41 0.08
42 0.14
43 0.19
44 0.26
45 0.29
46 0.32
47 0.34
48 0.4
49 0.43
50 0.39
51 0.36
52 0.35
53 0.32
54 0.3
55 0.27
56 0.2
57 0.16
58 0.14
59 0.15
60 0.14
61 0.2
62 0.2
63 0.21
64 0.23
65 0.26
66 0.28
67 0.28
68 0.33
69 0.31
70 0.35
71 0.37
72 0.37
73 0.39
74 0.45
75 0.52
76 0.52
77 0.58
78 0.62
79 0.69
80 0.79
81 0.83
82 0.84
83 0.85
84 0.82