Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3UN24

Protein Details
Accession A0A2D3UN24    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-44GLKLKGAGVDKKKKKKSKPKPPAENKSKEDGABasic
NLS Segment(s)
PositionSequence
15-39KLKGAGVDKKKKKKSKPKPPAENKS
85-93RHEERRKKR
Subcellular Location(s) nucl 18.5, mito_nucl 12.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MPSSDYSSAIGGGLKLKGAGVDKKKKKKSKPKPPAENKSKEDGAGSAAENESSALQKALAEEEGEVEKPQESEVNTFGKTEAQRRHEERRKKRASLASQLYIAGHARLTIPQLDERLKREGVQTHKERVQQLNKYLSTLSEHNDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.11
5 0.14
6 0.22
7 0.29
8 0.4
9 0.5
10 0.6
11 0.71
12 0.78
13 0.85
14 0.89
15 0.9
16 0.91
17 0.92
18 0.93
19 0.94
20 0.96
21 0.96
22 0.95
23 0.92
24 0.85
25 0.8
26 0.7
27 0.59
28 0.49
29 0.38
30 0.29
31 0.21
32 0.18
33 0.12
34 0.11
35 0.1
36 0.09
37 0.09
38 0.08
39 0.06
40 0.07
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.11
61 0.12
62 0.12
63 0.12
64 0.12
65 0.14
66 0.15
67 0.2
68 0.24
69 0.27
70 0.33
71 0.38
72 0.48
73 0.53
74 0.63
75 0.67
76 0.72
77 0.75
78 0.72
79 0.74
80 0.73
81 0.71
82 0.7
83 0.65
84 0.56
85 0.5
86 0.47
87 0.39
88 0.31
89 0.25
90 0.15
91 0.09
92 0.07
93 0.07
94 0.07
95 0.09
96 0.09
97 0.11
98 0.12
99 0.16
100 0.21
101 0.23
102 0.26
103 0.29
104 0.28
105 0.28
106 0.3
107 0.34
108 0.36
109 0.43
110 0.45
111 0.48
112 0.53
113 0.56
114 0.57
115 0.6
116 0.62
117 0.59
118 0.61
119 0.62
120 0.57
121 0.54
122 0.49
123 0.41
124 0.37
125 0.32
126 0.28
127 0.24
128 0.24
129 0.25
130 0.29
131 0.27