Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3VKA1

Protein Details
Accession A0A2D3VKA1    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
108-130AAATPKAKRGRPKKAATPKPVEEHydrophilic
NLS Segment(s)
PositionSequence
90-95KKRKAK
111-124TPKAKRGRPKKAAT
Subcellular Location(s) nucl 13, cyto_nucl 12.833, cyto 9.5, mito_nucl 7.999
Family & Domain DBs
Amino Acid Sequences MVSYDYELSKATLNENDKDRIVCLYLNSDPASVDWAKATKDYGSASVESFKKTTANMLKKLDTAGAKVSGDGNATVASATPAPVTPASGKKRKAKSEVAADGDVEGGAAATPKAKRGRPKKAATPKPVEEDAMDEDNEDAAEKGIVKKESVDDLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.32
3 0.35
4 0.33
5 0.33
6 0.31
7 0.26
8 0.24
9 0.2
10 0.17
11 0.19
12 0.18
13 0.21
14 0.21
15 0.19
16 0.17
17 0.16
18 0.19
19 0.15
20 0.14
21 0.12
22 0.13
23 0.13
24 0.14
25 0.15
26 0.11
27 0.13
28 0.14
29 0.14
30 0.15
31 0.15
32 0.15
33 0.2
34 0.2
35 0.2
36 0.19
37 0.17
38 0.16
39 0.15
40 0.22
41 0.26
42 0.31
43 0.35
44 0.39
45 0.39
46 0.39
47 0.39
48 0.35
49 0.26
50 0.2
51 0.16
52 0.15
53 0.13
54 0.13
55 0.13
56 0.1
57 0.1
58 0.09
59 0.07
60 0.05
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.06
72 0.08
73 0.16
74 0.22
75 0.28
76 0.34
77 0.41
78 0.49
79 0.54
80 0.58
81 0.58
82 0.58
83 0.61
84 0.6
85 0.56
86 0.49
87 0.42
88 0.36
89 0.29
90 0.22
91 0.13
92 0.07
93 0.03
94 0.03
95 0.03
96 0.03
97 0.06
98 0.06
99 0.12
100 0.18
101 0.22
102 0.33
103 0.43
104 0.54
105 0.61
106 0.69
107 0.74
108 0.8
109 0.86
110 0.85
111 0.84
112 0.77
113 0.74
114 0.67
115 0.57
116 0.47
117 0.4
118 0.35
119 0.29
120 0.24
121 0.18
122 0.17
123 0.16
124 0.15
125 0.12
126 0.08
127 0.06
128 0.07
129 0.08
130 0.11
131 0.17
132 0.18
133 0.18
134 0.2
135 0.22