Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3VHV9

Protein Details
Accession A0A2D3VHV9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
103-133GCSKSRHFRNHLPRRQKIRRGAIRNRTCCRKBasic
NLS Segment(s)
PositionSequence
115-122PRRQKIRR
Subcellular Location(s) nucl 17.5, cyto_nucl 11.333, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011009  Kinase-like_dom_sf  
Amino Acid Sequences MLAQRVDKVIASEVATMDFVRNVVGIPVPKVLAWDGQVSNHAESEYILMEQAEGTQLSDLWTDMDIYDKLKVVDDVVDIQKKLQSITFSRLGSLYFTSDAFPGCSKSRHFRNHLPRRQKIRRGAIRNRTCCRKVILGDWNYTRSRPLARCSQLPPRTFQQRAIENLFLRQKQRQSTPLPQIMPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.12
5 0.1
6 0.09
7 0.08
8 0.08
9 0.07
10 0.07
11 0.1
12 0.1
13 0.11
14 0.13
15 0.13
16 0.13
17 0.14
18 0.14
19 0.13
20 0.13
21 0.16
22 0.15
23 0.15
24 0.19
25 0.2
26 0.2
27 0.18
28 0.17
29 0.12
30 0.12
31 0.12
32 0.1
33 0.08
34 0.07
35 0.06
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.06
47 0.06
48 0.06
49 0.06
50 0.06
51 0.08
52 0.07
53 0.08
54 0.09
55 0.09
56 0.09
57 0.1
58 0.1
59 0.08
60 0.08
61 0.08
62 0.1
63 0.12
64 0.14
65 0.13
66 0.14
67 0.14
68 0.14
69 0.14
70 0.12
71 0.12
72 0.13
73 0.17
74 0.22
75 0.2
76 0.21
77 0.2
78 0.19
79 0.17
80 0.15
81 0.12
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.08
89 0.1
90 0.1
91 0.12
92 0.15
93 0.21
94 0.3
95 0.37
96 0.42
97 0.5
98 0.6
99 0.69
100 0.75
101 0.79
102 0.78
103 0.82
104 0.85
105 0.84
106 0.82
107 0.82
108 0.82
109 0.82
110 0.83
111 0.84
112 0.84
113 0.84
114 0.81
115 0.79
116 0.71
117 0.64
118 0.58
119 0.53
120 0.45
121 0.44
122 0.46
123 0.41
124 0.45
125 0.45
126 0.45
127 0.4
128 0.38
129 0.33
130 0.26
131 0.3
132 0.28
133 0.31
134 0.36
135 0.4
136 0.45
137 0.49
138 0.57
139 0.57
140 0.56
141 0.56
142 0.54
143 0.59
144 0.56
145 0.57
146 0.55
147 0.53
148 0.57
149 0.58
150 0.55
151 0.46
152 0.52
153 0.52
154 0.47
155 0.46
156 0.47
157 0.48
158 0.5
159 0.56
160 0.57
161 0.58
162 0.64
163 0.7
164 0.7
165 0.66