Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V3R8

Protein Details
Accession A0A2D3V3R8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-53VSDSEVKIRKREKFLNKAGHVHydrophilic
98-118AFKSAKPDRRSKKYVDRPEFGHydrophilic
477-503FDERGEWRRRRWTRLVERQPDRNTDKQHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, nucl 6, mito 3, golg 3, cyto 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MDDRNVIANRDEAIPVLRIPSRDDDNDDISSAVSDSEVKIRKREKFLNKAGHVGNMFKDKVDEFSTPEARQTLQDRMFASILSQIIPPEEMGEGEHDAFKSAKPDRRSKKYVDRPEFGPRLMTYNFRRFNSRIGIVFVMQNRLIRLFTWQTPTATLSFLAIHSLLCLKPHLLPLVPLVGLLFSIMIPSFLARHPAPANDPMMEPSFQGPPSAPASRVKPAAEMSHDFWRNMRDLQNCMEDFSRIHDAGNEYITPYTNFSDEALSSSLYFILFALSCAAFLASQLVPWRAIALIGGWVITVSGHPQAQKTITSTRNMSQLRQTLEAFQMTFRNWVETDVVLDEPSEQRQVEVFXLQRFHSPSDTWERWLFSPSPYDPLSPARIGDDRPKGTQFFEDVQPPRGWIWKQKKWTLDLLSREWVEERLITGVEIETEGERWVYDLRPDELEELLDNPLRVGKNKKRVKSIPMSGWEEGNGNGFDERGEWRRRRWTRLVERQPDRNTDKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.19
4 0.2
5 0.19
6 0.22
7 0.27
8 0.31
9 0.32
10 0.37
11 0.38
12 0.39
13 0.4
14 0.36
15 0.31
16 0.25
17 0.22
18 0.17
19 0.12
20 0.08
21 0.08
22 0.08
23 0.16
24 0.23
25 0.25
26 0.33
27 0.41
28 0.49
29 0.57
30 0.66
31 0.68
32 0.72
33 0.8
34 0.82
35 0.77
36 0.76
37 0.69
38 0.64
39 0.55
40 0.47
41 0.41
42 0.37
43 0.35
44 0.28
45 0.28
46 0.23
47 0.25
48 0.27
49 0.24
50 0.21
51 0.29
52 0.34
53 0.32
54 0.34
55 0.31
56 0.28
57 0.31
58 0.31
59 0.33
60 0.31
61 0.34
62 0.33
63 0.35
64 0.34
65 0.29
66 0.26
67 0.21
68 0.18
69 0.15
70 0.15
71 0.11
72 0.12
73 0.12
74 0.11
75 0.09
76 0.09
77 0.08
78 0.08
79 0.1
80 0.1
81 0.11
82 0.12
83 0.11
84 0.12
85 0.13
86 0.13
87 0.17
88 0.23
89 0.29
90 0.35
91 0.45
92 0.54
93 0.63
94 0.69
95 0.71
96 0.75
97 0.79
98 0.83
99 0.81
100 0.76
101 0.7
102 0.74
103 0.69
104 0.58
105 0.5
106 0.4
107 0.36
108 0.33
109 0.36
110 0.33
111 0.39
112 0.45
113 0.42
114 0.48
115 0.44
116 0.49
117 0.48
118 0.45
119 0.37
120 0.34
121 0.34
122 0.29
123 0.31
124 0.27
125 0.23
126 0.21
127 0.2
128 0.18
129 0.17
130 0.17
131 0.13
132 0.17
133 0.18
134 0.2
135 0.25
136 0.26
137 0.25
138 0.26
139 0.28
140 0.23
141 0.2
142 0.17
143 0.12
144 0.11
145 0.1
146 0.1
147 0.08
148 0.07
149 0.07
150 0.09
151 0.08
152 0.08
153 0.09
154 0.09
155 0.11
156 0.13
157 0.14
158 0.12
159 0.13
160 0.13
161 0.15
162 0.13
163 0.11
164 0.09
165 0.07
166 0.07
167 0.06
168 0.05
169 0.03
170 0.03
171 0.03
172 0.03
173 0.03
174 0.04
175 0.05
176 0.05
177 0.1
178 0.1
179 0.13
180 0.14
181 0.16
182 0.18
183 0.2
184 0.21
185 0.18
186 0.18
187 0.17
188 0.17
189 0.16
190 0.14
191 0.13
192 0.13
193 0.12
194 0.12
195 0.11
196 0.12
197 0.15
198 0.16
199 0.16
200 0.17
201 0.2
202 0.23
203 0.25
204 0.23
205 0.21
206 0.21
207 0.22
208 0.22
209 0.21
210 0.21
211 0.26
212 0.27
213 0.25
214 0.25
215 0.25
216 0.23
217 0.23
218 0.25
219 0.2
220 0.21
221 0.23
222 0.28
223 0.26
224 0.25
225 0.23
226 0.19
227 0.16
228 0.17
229 0.18
230 0.13
231 0.13
232 0.13
233 0.14
234 0.14
235 0.15
236 0.12
237 0.09
238 0.09
239 0.09
240 0.08
241 0.08
242 0.08
243 0.07
244 0.08
245 0.08
246 0.08
247 0.08
248 0.09
249 0.08
250 0.08
251 0.08
252 0.08
253 0.07
254 0.06
255 0.06
256 0.04
257 0.05
258 0.04
259 0.04
260 0.06
261 0.05
262 0.05
263 0.05
264 0.05
265 0.04
266 0.04
267 0.07
268 0.05
269 0.06
270 0.08
271 0.09
272 0.09
273 0.09
274 0.09
275 0.06
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.06
289 0.07
290 0.08
291 0.09
292 0.1
293 0.12
294 0.13
295 0.15
296 0.2
297 0.22
298 0.24
299 0.26
300 0.27
301 0.34
302 0.34
303 0.33
304 0.32
305 0.34
306 0.33
307 0.34
308 0.32
309 0.26
310 0.27
311 0.26
312 0.2
313 0.17
314 0.16
315 0.14
316 0.16
317 0.14
318 0.15
319 0.14
320 0.15
321 0.15
322 0.13
323 0.14
324 0.12
325 0.12
326 0.09
327 0.09
328 0.09
329 0.09
330 0.1
331 0.11
332 0.1
333 0.1
334 0.1
335 0.13
336 0.15
337 0.21
338 0.21
339 0.22
340 0.25
341 0.26
342 0.26
343 0.25
344 0.24
345 0.17
346 0.21
347 0.28
348 0.26
349 0.29
350 0.3
351 0.31
352 0.29
353 0.33
354 0.3
355 0.22
356 0.27
357 0.24
358 0.26
359 0.25
360 0.25
361 0.23
362 0.26
363 0.28
364 0.23
365 0.22
366 0.21
367 0.22
368 0.24
369 0.3
370 0.35
371 0.33
372 0.36
373 0.38
374 0.36
375 0.36
376 0.36
377 0.31
378 0.26
379 0.26
380 0.31
381 0.31
382 0.34
383 0.33
384 0.31
385 0.29
386 0.31
387 0.31
388 0.33
389 0.41
390 0.45
391 0.54
392 0.59
393 0.63
394 0.61
395 0.67
396 0.64
397 0.61
398 0.58
399 0.54
400 0.53
401 0.48
402 0.45
403 0.38
404 0.31
405 0.25
406 0.19
407 0.16
408 0.12
409 0.12
410 0.11
411 0.1
412 0.09
413 0.09
414 0.08
415 0.08
416 0.07
417 0.08
418 0.08
419 0.07
420 0.07
421 0.08
422 0.1
423 0.1
424 0.14
425 0.17
426 0.19
427 0.21
428 0.23
429 0.23
430 0.22
431 0.21
432 0.18
433 0.15
434 0.16
435 0.15
436 0.14
437 0.13
438 0.17
439 0.17
440 0.21
441 0.3
442 0.37
443 0.47
444 0.56
445 0.63
446 0.69
447 0.74
448 0.79
449 0.79
450 0.79
451 0.77
452 0.76
453 0.75
454 0.66
455 0.6
456 0.52
457 0.42
458 0.34
459 0.28
460 0.2
461 0.15
462 0.14
463 0.13
464 0.12
465 0.12
466 0.17
467 0.21
468 0.3
469 0.33
470 0.41
471 0.52
472 0.6
473 0.67
474 0.72
475 0.76
476 0.78
477 0.85
478 0.88
479 0.88
480 0.88
481 0.89
482 0.86
483 0.84
484 0.8