Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V8A6

Protein Details
Accession A0A2D3V8A6   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
240-269SNGVREQMARKREKRRQKASRRALRNATFVHydrophilic
NLS Segment(s)
PositionSequence
249-263ARKREKRRQKASRRA
Subcellular Location(s) nucl 17, cyto_nucl 16, cyto 9
Family & Domain DBs
Amino Acid Sequences MVGRYTRMSLDGGENPIEGEIRHLVDKLDSIIEEVDEAEDAASKAAARYAEKVNSASRDASTIYQKIDELRDQQVQGMSYLDRAGWIASKPAPVAPQEVQAELLECRDDSPRSNEEALIAKGLFQAGNTVIGARRNRPSSHHGTRNANDLREYNQAHXRYIGHPNVTKPNRPSDRLESGRAQIERMQRQSDAPIPPEIALPIRKSAEGSRADKKGTDHKDPNVKKGEKHENISRDEASAASNGVREQMARKREKRRQKASRRALRNATFVDLTPAHQAGGKATAQKSNPGAIANDESDRPVNDETDGPVGGFTFNNLPIRNARDAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.21
4 0.2
5 0.14
6 0.13
7 0.13
8 0.14
9 0.15
10 0.15
11 0.15
12 0.16
13 0.17
14 0.16
15 0.14
16 0.12
17 0.12
18 0.12
19 0.12
20 0.11
21 0.1
22 0.08
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.06
32 0.09
33 0.11
34 0.11
35 0.15
36 0.2
37 0.24
38 0.26
39 0.28
40 0.3
41 0.31
42 0.32
43 0.29
44 0.24
45 0.22
46 0.22
47 0.23
48 0.25
49 0.24
50 0.22
51 0.22
52 0.22
53 0.23
54 0.25
55 0.25
56 0.24
57 0.26
58 0.29
59 0.28
60 0.3
61 0.29
62 0.26
63 0.22
64 0.2
65 0.15
66 0.12
67 0.12
68 0.1
69 0.08
70 0.07
71 0.07
72 0.08
73 0.08
74 0.1
75 0.11
76 0.13
77 0.13
78 0.14
79 0.16
80 0.15
81 0.19
82 0.17
83 0.22
84 0.21
85 0.21
86 0.21
87 0.19
88 0.19
89 0.14
90 0.14
91 0.08
92 0.07
93 0.08
94 0.1
95 0.11
96 0.12
97 0.17
98 0.19
99 0.23
100 0.24
101 0.23
102 0.22
103 0.24
104 0.22
105 0.18
106 0.15
107 0.12
108 0.11
109 0.12
110 0.1
111 0.06
112 0.07
113 0.06
114 0.07
115 0.06
116 0.07
117 0.07
118 0.12
119 0.14
120 0.16
121 0.2
122 0.23
123 0.24
124 0.28
125 0.34
126 0.39
127 0.46
128 0.5
129 0.52
130 0.55
131 0.55
132 0.59
133 0.55
134 0.46
135 0.39
136 0.32
137 0.29
138 0.28
139 0.29
140 0.23
141 0.26
142 0.26
143 0.25
144 0.25
145 0.23
146 0.22
147 0.24
148 0.26
149 0.22
150 0.23
151 0.33
152 0.35
153 0.37
154 0.35
155 0.42
156 0.4
157 0.42
158 0.45
159 0.42
160 0.48
161 0.47
162 0.49
163 0.41
164 0.39
165 0.4
166 0.36
167 0.3
168 0.26
169 0.3
170 0.31
171 0.31
172 0.31
173 0.27
174 0.27
175 0.29
176 0.3
177 0.25
178 0.22
179 0.2
180 0.19
181 0.19
182 0.19
183 0.16
184 0.13
185 0.13
186 0.13
187 0.14
188 0.14
189 0.14
190 0.16
191 0.17
192 0.21
193 0.25
194 0.29
195 0.32
196 0.34
197 0.34
198 0.35
199 0.36
200 0.38
201 0.38
202 0.43
203 0.42
204 0.46
205 0.56
206 0.56
207 0.61
208 0.62
209 0.58
210 0.52
211 0.56
212 0.61
213 0.55
214 0.59
215 0.59
216 0.55
217 0.56
218 0.57
219 0.48
220 0.38
221 0.33
222 0.27
223 0.21
224 0.16
225 0.12
226 0.09
227 0.09
228 0.08
229 0.09
230 0.09
231 0.08
232 0.13
233 0.2
234 0.28
235 0.37
236 0.45
237 0.55
238 0.64
239 0.75
240 0.81
241 0.85
242 0.87
243 0.89
244 0.92
245 0.93
246 0.94
247 0.91
248 0.89
249 0.87
250 0.81
251 0.76
252 0.66
253 0.59
254 0.5
255 0.41
256 0.38
257 0.29
258 0.25
259 0.23
260 0.21
261 0.17
262 0.18
263 0.18
264 0.14
265 0.18
266 0.18
267 0.2
268 0.22
269 0.27
270 0.26
271 0.32
272 0.33
273 0.32
274 0.31
275 0.27
276 0.26
277 0.24
278 0.27
279 0.24
280 0.23
281 0.21
282 0.22
283 0.22
284 0.21
285 0.21
286 0.19
287 0.18
288 0.17
289 0.18
290 0.19
291 0.2
292 0.19
293 0.16
294 0.14
295 0.14
296 0.13
297 0.11
298 0.11
299 0.12
300 0.16
301 0.21
302 0.21
303 0.24
304 0.28
305 0.34