Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PA09

Protein Details
Accession J3PA09    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
35-59ATVSNSSRKRQRVRRRREDNVPAPLHydrophilic
NLS Segment(s)
PositionSequence
42-50RKRQRVRRR
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MKANNLAGTLKKLKARVGMKETQQGAAAQDRQNVATVSNSSRKRQRVRRRREDNVPAPLEGWADLHGPGSSLLSPSPRDLRNSATGVARGGGPGAGAATGTGFASGRAVSGGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.47
4 0.49
5 0.51
6 0.51
7 0.57
8 0.55
9 0.47
10 0.42
11 0.34
12 0.29
13 0.27
14 0.28
15 0.22
16 0.24
17 0.23
18 0.23
19 0.23
20 0.21
21 0.17
22 0.14
23 0.14
24 0.15
25 0.22
26 0.25
27 0.28
28 0.35
29 0.42
30 0.5
31 0.58
32 0.66
33 0.69
34 0.77
35 0.84
36 0.86
37 0.86
38 0.86
39 0.85
40 0.8
41 0.77
42 0.67
43 0.56
44 0.47
45 0.4
46 0.31
47 0.21
48 0.14
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.06
59 0.06
60 0.08
61 0.09
62 0.11
63 0.17
64 0.18
65 0.21
66 0.22
67 0.26
68 0.3
69 0.31
70 0.3
71 0.27
72 0.26
73 0.23
74 0.22
75 0.17
76 0.12
77 0.1
78 0.08
79 0.06
80 0.05
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.06
93 0.06