Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3VK71

Protein Details
Accession A0A2D3VK71    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
87-106ASRIHATKRRSQHQDEKVEPHydrophilic
513-533PKSSDSKSIKSTKNGKRKSFLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001398  Macrophage_inhib_fac  
IPR014347  Tautomerase/MIF_sf  
Pfam View protein in Pfam  
PF01187  MIF  
Amino Acid Sequences MSSPPLPAILCPGVVSQNPVPPQSQRPSRSSSLSASTFCLLDALEPTFAPRARSSLPSLDTLAGVLGTSTFDDLLRTHLGDKDSMNASRIHATKRRSQHQDEKVEPKENVNNSVRERVLKDSPIIAELRTNVIIKDEFTLVKDLTLHLAARYTRNDSAIMVQVDHSVCLALGGTFDPCYIXTLTTGSSQMGPIMNRRNAALIQSFLADVLGVPAERGVVKFQPSPEENFAYNGTTLLAEIERREKQHEKGHGSRRSVECYSRKSTPSPKKSASKLNAEVKINDKTMQEAKVIEAITESKFVEPKTLTTHRPKTAPDSKRKSGTLPVGVSATILSPGGVFELPASDMERIRSTPIQRQSSGSNGLRMNPVSSNDSEYQKRPSSGMTRATSGEFTRVKDKRRSNSHLLSLSDPLAAPAPPPIRIQRPIALSPKEHSFLQNEYTKPGQQNPRSSNVNRMSAPISMREKPMPKVFGSDGVISEDSTQELTDSEPTANTAKRRSTMTATPKIPESPIEPKSSDSKSIKSTKNGKRKSFLAAFRRSTVTAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.23
4 0.28
5 0.3
6 0.31
7 0.32
8 0.33
9 0.41
10 0.45
11 0.51
12 0.51
13 0.53
14 0.59
15 0.61
16 0.62
17 0.57
18 0.52
19 0.49
20 0.47
21 0.43
22 0.39
23 0.36
24 0.3
25 0.25
26 0.21
27 0.14
28 0.12
29 0.13
30 0.12
31 0.11
32 0.11
33 0.13
34 0.18
35 0.19
36 0.21
37 0.2
38 0.22
39 0.25
40 0.29
41 0.32
42 0.34
43 0.35
44 0.35
45 0.36
46 0.32
47 0.29
48 0.25
49 0.2
50 0.13
51 0.1
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.11
62 0.13
63 0.13
64 0.15
65 0.18
66 0.19
67 0.2
68 0.21
69 0.22
70 0.24
71 0.24
72 0.24
73 0.22
74 0.23
75 0.27
76 0.3
77 0.32
78 0.34
79 0.37
80 0.44
81 0.52
82 0.6
83 0.62
84 0.68
85 0.71
86 0.75
87 0.8
88 0.79
89 0.79
90 0.75
91 0.72
92 0.64
93 0.58
94 0.56
95 0.49
96 0.5
97 0.45
98 0.45
99 0.43
100 0.48
101 0.44
102 0.4
103 0.4
104 0.37
105 0.38
106 0.34
107 0.32
108 0.29
109 0.28
110 0.27
111 0.25
112 0.2
113 0.17
114 0.16
115 0.17
116 0.16
117 0.16
118 0.13
119 0.15
120 0.15
121 0.14
122 0.15
123 0.14
124 0.13
125 0.14
126 0.17
127 0.14
128 0.14
129 0.14
130 0.12
131 0.12
132 0.13
133 0.12
134 0.1
135 0.13
136 0.14
137 0.17
138 0.19
139 0.22
140 0.22
141 0.23
142 0.23
143 0.21
144 0.22
145 0.23
146 0.21
147 0.17
148 0.16
149 0.17
150 0.17
151 0.16
152 0.13
153 0.08
154 0.07
155 0.07
156 0.07
157 0.04
158 0.04
159 0.04
160 0.05
161 0.05
162 0.05
163 0.06
164 0.06
165 0.08
166 0.08
167 0.08
168 0.09
169 0.1
170 0.11
171 0.13
172 0.13
173 0.11
174 0.1
175 0.11
176 0.12
177 0.11
178 0.15
179 0.21
180 0.23
181 0.23
182 0.23
183 0.24
184 0.22
185 0.24
186 0.2
187 0.14
188 0.12
189 0.12
190 0.12
191 0.1
192 0.09
193 0.06
194 0.05
195 0.04
196 0.04
197 0.03
198 0.03
199 0.03
200 0.04
201 0.04
202 0.05
203 0.06
204 0.08
205 0.11
206 0.13
207 0.14
208 0.19
209 0.2
210 0.24
211 0.25
212 0.26
213 0.24
214 0.24
215 0.24
216 0.19
217 0.18
218 0.14
219 0.1
220 0.08
221 0.07
222 0.06
223 0.06
224 0.05
225 0.06
226 0.11
227 0.13
228 0.14
229 0.19
230 0.22
231 0.27
232 0.34
233 0.41
234 0.43
235 0.5
236 0.59
237 0.6
238 0.59
239 0.6
240 0.55
241 0.53
242 0.47
243 0.45
244 0.41
245 0.4
246 0.42
247 0.4
248 0.39
249 0.38
250 0.47
251 0.51
252 0.54
253 0.55
254 0.57
255 0.59
256 0.61
257 0.66
258 0.61
259 0.58
260 0.57
261 0.57
262 0.56
263 0.51
264 0.48
265 0.42
266 0.4
267 0.33
268 0.28
269 0.21
270 0.19
271 0.2
272 0.2
273 0.18
274 0.15
275 0.14
276 0.15
277 0.15
278 0.12
279 0.1
280 0.1
281 0.1
282 0.11
283 0.11
284 0.08
285 0.1
286 0.1
287 0.13
288 0.12
289 0.13
290 0.19
291 0.23
292 0.28
293 0.35
294 0.42
295 0.42
296 0.44
297 0.44
298 0.46
299 0.51
300 0.55
301 0.56
302 0.58
303 0.6
304 0.62
305 0.62
306 0.55
307 0.52
308 0.49
309 0.44
310 0.36
311 0.32
312 0.27
313 0.26
314 0.24
315 0.17
316 0.12
317 0.06
318 0.05
319 0.04
320 0.04
321 0.04
322 0.05
323 0.04
324 0.04
325 0.04
326 0.05
327 0.05
328 0.06
329 0.07
330 0.07
331 0.08
332 0.1
333 0.11
334 0.11
335 0.14
336 0.18
337 0.2
338 0.26
339 0.35
340 0.38
341 0.38
342 0.4
343 0.38
344 0.38
345 0.43
346 0.36
347 0.33
348 0.28
349 0.29
350 0.29
351 0.27
352 0.25
353 0.19
354 0.2
355 0.18
356 0.18
357 0.21
358 0.22
359 0.26
360 0.27
361 0.28
362 0.32
363 0.32
364 0.32
365 0.28
366 0.3
367 0.31
368 0.34
369 0.4
370 0.35
371 0.34
372 0.35
373 0.35
374 0.33
375 0.28
376 0.28
377 0.22
378 0.23
379 0.3
380 0.33
381 0.39
382 0.46
383 0.54
384 0.56
385 0.64
386 0.7
387 0.7
388 0.72
389 0.73
390 0.69
391 0.63
392 0.56
393 0.48
394 0.41
395 0.32
396 0.25
397 0.18
398 0.14
399 0.12
400 0.09
401 0.13
402 0.14
403 0.15
404 0.18
405 0.23
406 0.28
407 0.31
408 0.35
409 0.34
410 0.38
411 0.42
412 0.47
413 0.46
414 0.42
415 0.41
416 0.42
417 0.4
418 0.35
419 0.32
420 0.27
421 0.26
422 0.3
423 0.33
424 0.29
425 0.31
426 0.33
427 0.35
428 0.35
429 0.4
430 0.44
431 0.46
432 0.55
433 0.56
434 0.6
435 0.63
436 0.61
437 0.63
438 0.6
439 0.58
440 0.49
441 0.47
442 0.42
443 0.38
444 0.38
445 0.35
446 0.34
447 0.31
448 0.35
449 0.39
450 0.41
451 0.44
452 0.49
453 0.46
454 0.41
455 0.43
456 0.41
457 0.4
458 0.39
459 0.35
460 0.28
461 0.28
462 0.28
463 0.22
464 0.22
465 0.16
466 0.13
467 0.12
468 0.11
469 0.07
470 0.07
471 0.09
472 0.1
473 0.11
474 0.11
475 0.11
476 0.13
477 0.18
478 0.21
479 0.24
480 0.28
481 0.32
482 0.34
483 0.39
484 0.41
485 0.44
486 0.49
487 0.55
488 0.58
489 0.56
490 0.55
491 0.54
492 0.51
493 0.46
494 0.39
495 0.36
496 0.35
497 0.37
498 0.39
499 0.37
500 0.38
501 0.44
502 0.45
503 0.48
504 0.44
505 0.44
506 0.48
507 0.56
508 0.6
509 0.63
510 0.69
511 0.7
512 0.77
513 0.82
514 0.81
515 0.79
516 0.76
517 0.76
518 0.74
519 0.73
520 0.72
521 0.72
522 0.69
523 0.66
524 0.66