Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NIL9

Protein Details
Accession J3NIL9   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
13-33SVSTKGPTRRRWPSRAARSPWHydrophilic
NLS Segment(s)
PositionSequence
90-91RK
Subcellular Location(s) mito 21.5, mito_nucl 12, cyto 4
Family & Domain DBs
Amino Acid Sequences MGKLKRMIWVNSSVSTKGPTRRRWPSRAARSPWMMVVTGSWTWRTREGGGQDKGKQPEGSGQNLAGDVRRKVHELEAKVAASAKAKAEVRKTGRERSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.33
4 0.34
5 0.4
6 0.43
7 0.5
8 0.6
9 0.67
10 0.7
11 0.75
12 0.77
13 0.8
14 0.81
15 0.78
16 0.74
17 0.69
18 0.64
19 0.56
20 0.46
21 0.35
22 0.25
23 0.19
24 0.15
25 0.12
26 0.12
27 0.12
28 0.12
29 0.13
30 0.15
31 0.17
32 0.15
33 0.18
34 0.22
35 0.28
36 0.3
37 0.33
38 0.34
39 0.37
40 0.38
41 0.36
42 0.32
43 0.24
44 0.28
45 0.27
46 0.27
47 0.23
48 0.21
49 0.2
50 0.2
51 0.2
52 0.15
53 0.15
54 0.13
55 0.15
56 0.16
57 0.17
58 0.18
59 0.26
60 0.29
61 0.3
62 0.33
63 0.34
64 0.33
65 0.32
66 0.31
67 0.25
68 0.21
69 0.2
70 0.17
71 0.19
72 0.23
73 0.27
74 0.32
75 0.4
76 0.44
77 0.52
78 0.57