Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J8UBQ6

Protein Details
Accession J8UBQ6    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-83IKTPAPKKESIRKRLKAKLIPHydrophilic
NLS Segment(s)
PositionSequence
67-79APKKESIRKRLKA
Subcellular Location(s) mito 8, nucl 3.5, cyto_nucl 3.5, extr 3, E.R. 3, vacu 3, cyto 2.5, plas 2
Family & Domain DBs
Amino Acid Sequences RVRIFSRAISSTQLKNAKLFLLLPYFITAIFNCLYKLKTFKATDTILLKKDRTNSEPIAPVLIKTPAPKKESIRKRLKAKLIPVSTPNLLNPFLLVRRNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.36
4 0.31
5 0.28
6 0.26
7 0.2
8 0.18
9 0.17
10 0.16
11 0.16
12 0.15
13 0.14
14 0.14
15 0.11
16 0.1
17 0.1
18 0.1
19 0.09
20 0.1
21 0.11
22 0.12
23 0.16
24 0.15
25 0.23
26 0.23
27 0.24
28 0.28
29 0.28
30 0.3
31 0.31
32 0.32
33 0.28
34 0.29
35 0.28
36 0.25
37 0.29
38 0.29
39 0.27
40 0.29
41 0.27
42 0.28
43 0.3
44 0.28
45 0.26
46 0.22
47 0.2
48 0.16
49 0.16
50 0.14
51 0.15
52 0.21
53 0.24
54 0.27
55 0.31
56 0.36
57 0.45
58 0.55
59 0.62
60 0.66
61 0.69
62 0.76
63 0.8
64 0.83
65 0.8
66 0.78
67 0.78
68 0.72
69 0.67
70 0.61
71 0.57
72 0.5
73 0.44
74 0.38
75 0.31
76 0.27
77 0.23
78 0.21
79 0.2
80 0.21