Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PAH0

Protein Details
Accession J3PAH0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-79LTPPCLPHCVTRRRKRRRAAAAAATWSHydrophilic
NLS Segment(s)
PositionSequence
64-71RRRKRRRA
Subcellular Location(s) nucl 13, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
Amino Acid Sequences MHGTSQSAAVADAGPAGGWSMRPSPPSPPGTDVASAGWCNVLVRLSLSNQPNLTPPCLPHCVTRRRKRRRAAAAAATWSLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.05
4 0.04
5 0.04
6 0.07
7 0.09
8 0.11
9 0.14
10 0.16
11 0.2
12 0.27
13 0.3
14 0.3
15 0.3
16 0.3
17 0.3
18 0.29
19 0.25
20 0.19
21 0.17
22 0.14
23 0.11
24 0.09
25 0.07
26 0.06
27 0.06
28 0.05
29 0.04
30 0.05
31 0.06
32 0.08
33 0.13
34 0.15
35 0.17
36 0.17
37 0.18
38 0.22
39 0.23
40 0.24
41 0.19
42 0.19
43 0.22
44 0.26
45 0.27
46 0.3
47 0.36
48 0.45
49 0.54
50 0.63
51 0.69
52 0.76
53 0.84
54 0.87
55 0.9
56 0.9
57 0.89
58 0.88
59 0.87
60 0.82
61 0.77