Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V9Y0

Protein Details
Accession A0A2D3V9Y0   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
121-142GCPCPLWNDRKVWKKRKAARRQHydrophilic
NLS Segment(s)
PositionSequence
132-143KVWKKRKAARRQ
Subcellular Location(s) mito 18.5, cyto_mito 12, cyto 4.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002867  IBR_dom  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01485  IBR  
Amino Acid Sequences MANKMVAQMKNLTLDRIYCSNKDCGSFIGPKHISKAXGFAVCTACEAITCTVCKNHAHEDDDCPEDPAIRQTRALAKKMGWKECWSCRAVICIFEKGCFHVKCTCEAELCYRCGGQWTWDRGCPCPLWNDRKVWKKRKAARRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.3
4 0.32
5 0.27
6 0.3
7 0.34
8 0.34
9 0.35
10 0.31
11 0.27
12 0.28
13 0.31
14 0.28
15 0.33
16 0.33
17 0.32
18 0.35
19 0.36
20 0.31
21 0.27
22 0.31
23 0.23
24 0.21
25 0.2
26 0.18
27 0.14
28 0.15
29 0.14
30 0.1
31 0.07
32 0.08
33 0.1
34 0.1
35 0.1
36 0.1
37 0.11
38 0.13
39 0.15
40 0.16
41 0.22
42 0.25
43 0.28
44 0.28
45 0.31
46 0.32
47 0.33
48 0.3
49 0.24
50 0.2
51 0.17
52 0.15
53 0.17
54 0.17
55 0.15
56 0.15
57 0.16
58 0.24
59 0.27
60 0.29
61 0.25
62 0.23
63 0.3
64 0.36
65 0.39
66 0.33
67 0.33
68 0.37
69 0.4
70 0.43
71 0.37
72 0.32
73 0.28
74 0.31
75 0.28
76 0.27
77 0.23
78 0.24
79 0.23
80 0.23
81 0.23
82 0.21
83 0.29
84 0.25
85 0.25
86 0.26
87 0.26
88 0.3
89 0.34
90 0.32
91 0.26
92 0.27
93 0.33
94 0.3
95 0.31
96 0.27
97 0.23
98 0.22
99 0.24
100 0.23
101 0.21
102 0.26
103 0.32
104 0.34
105 0.38
106 0.4
107 0.39
108 0.42
109 0.38
110 0.32
111 0.34
112 0.39
113 0.43
114 0.46
115 0.53
116 0.58
117 0.67
118 0.75
119 0.77
120 0.78
121 0.81
122 0.86