Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3VHW7

Protein Details
Accession A0A2D3VHW7   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
354-383EQKAYPPPPAPVKKPKKEKKLGTRFPGAKPBasic
NLS Segment(s)
PositionSequence
363-383PAPVKKPKKEKKLGTRFPGAK
Subcellular Location(s) cyto 20.5, cyto_nucl 13.333, nucl 5, mito_nucl 3.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002305  aa-tRNA-synth_Ic  
IPR014729  Rossmann-like_a/b/a_fold  
IPR002307  Tyr-tRNA-ligase  
IPR023617  Tyr-tRNA-ligase_arc/euk-type  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005524  F:ATP binding  
GO:0004831  F:tyrosine-tRNA ligase activity  
GO:0006437  P:tyrosyl-tRNA aminoacylation  
Pfam View protein in Pfam  
PF00579  tRNA-synt_1b  
CDD cd00805  TyrRS_core  
Amino Acid Sequences MADNGAPLAQTASEKLDLIKSNLQEVLNPEIIEEVLNKGERPLKIYWGTAXTGKPHCGYFVPMLKIAEFLAAGCEVKILLADVHGFLDNLKAPIELVEERAKYYRHCITAALKAVNVDTSRLIFVLGSTYQTTGDSGAKYFMDLLRLSTSVSGHDATKAGSEVVKQVDSPPLSSQIYPLMQALDEEYLGVDAQFGGVDQRKIFTLAVEALPRIGMKKRAHLMNPLIPGLQEGGKMSSSDPNSKIDLIDSPEVVTKKLKSAFCPPKQVDGNGVLSFVQYVLLPASALKNNGTPKFVVSRRDAEPLEYATIEEMHKDYLADVLQPQALKPAVTAALLEILAPIRETFEESKEWQEVEQKAYPPPPAPVKKPKKEKKLGTRFPGAKPAEGVEVKPDGHLEGPGAQEASVGKSTEEAMSKLSVAEGDKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.21
4 0.23
5 0.27
6 0.31
7 0.28
8 0.31
9 0.34
10 0.33
11 0.29
12 0.3
13 0.32
14 0.29
15 0.28
16 0.24
17 0.21
18 0.21
19 0.19
20 0.16
21 0.12
22 0.13
23 0.14
24 0.14
25 0.17
26 0.23
27 0.23
28 0.26
29 0.26
30 0.3
31 0.32
32 0.34
33 0.32
34 0.33
35 0.36
36 0.35
37 0.41
38 0.37
39 0.41
40 0.39
41 0.38
42 0.33
43 0.31
44 0.31
45 0.3
46 0.34
47 0.31
48 0.33
49 0.33
50 0.32
51 0.31
52 0.27
53 0.21
54 0.13
55 0.1
56 0.09
57 0.09
58 0.09
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.06
69 0.08
70 0.08
71 0.08
72 0.07
73 0.1
74 0.11
75 0.11
76 0.11
77 0.09
78 0.09
79 0.1
80 0.13
81 0.11
82 0.13
83 0.18
84 0.18
85 0.2
86 0.23
87 0.24
88 0.22
89 0.27
90 0.3
91 0.27
92 0.27
93 0.29
94 0.3
95 0.36
96 0.4
97 0.35
98 0.29
99 0.27
100 0.26
101 0.25
102 0.22
103 0.16
104 0.11
105 0.11
106 0.11
107 0.11
108 0.11
109 0.07
110 0.07
111 0.09
112 0.08
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.11
119 0.1
120 0.12
121 0.1
122 0.1
123 0.11
124 0.11
125 0.11
126 0.12
127 0.1
128 0.11
129 0.11
130 0.12
131 0.12
132 0.12
133 0.13
134 0.12
135 0.12
136 0.1
137 0.12
138 0.11
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.09
145 0.08
146 0.08
147 0.08
148 0.1
149 0.11
150 0.11
151 0.1
152 0.11
153 0.16
154 0.16
155 0.17
156 0.15
157 0.17
158 0.18
159 0.18
160 0.17
161 0.16
162 0.16
163 0.15
164 0.14
165 0.11
166 0.09
167 0.09
168 0.1
169 0.06
170 0.06
171 0.05
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.02
178 0.03
179 0.02
180 0.02
181 0.04
182 0.06
183 0.07
184 0.07
185 0.08
186 0.08
187 0.1
188 0.1
189 0.08
190 0.08
191 0.08
192 0.1
193 0.1
194 0.09
195 0.08
196 0.08
197 0.08
198 0.08
199 0.08
200 0.15
201 0.15
202 0.21
203 0.26
204 0.29
205 0.31
206 0.35
207 0.38
208 0.35
209 0.36
210 0.31
211 0.26
212 0.22
213 0.21
214 0.16
215 0.13
216 0.08
217 0.06
218 0.07
219 0.07
220 0.08
221 0.08
222 0.12
223 0.14
224 0.18
225 0.19
226 0.2
227 0.21
228 0.21
229 0.2
230 0.16
231 0.16
232 0.15
233 0.15
234 0.13
235 0.12
236 0.15
237 0.15
238 0.15
239 0.15
240 0.13
241 0.17
242 0.23
243 0.24
244 0.24
245 0.35
246 0.44
247 0.47
248 0.56
249 0.53
250 0.55
251 0.55
252 0.53
253 0.45
254 0.38
255 0.36
256 0.27
257 0.26
258 0.17
259 0.15
260 0.15
261 0.11
262 0.08
263 0.04
264 0.04
265 0.04
266 0.04
267 0.04
268 0.05
269 0.08
270 0.09
271 0.1
272 0.1
273 0.14
274 0.2
275 0.22
276 0.23
277 0.2
278 0.22
279 0.28
280 0.31
281 0.32
282 0.3
283 0.34
284 0.35
285 0.4
286 0.38
287 0.33
288 0.32
289 0.28
290 0.26
291 0.21
292 0.18
293 0.13
294 0.14
295 0.12
296 0.11
297 0.1
298 0.09
299 0.09
300 0.09
301 0.08
302 0.09
303 0.09
304 0.09
305 0.09
306 0.1
307 0.11
308 0.11
309 0.11
310 0.13
311 0.13
312 0.12
313 0.12
314 0.13
315 0.12
316 0.12
317 0.12
318 0.08
319 0.09
320 0.09
321 0.09
322 0.07
323 0.07
324 0.07
325 0.07
326 0.07
327 0.06
328 0.07
329 0.11
330 0.13
331 0.15
332 0.19
333 0.2
334 0.25
335 0.25
336 0.25
337 0.23
338 0.28
339 0.28
340 0.3
341 0.33
342 0.31
343 0.34
344 0.36
345 0.38
346 0.32
347 0.35
348 0.4
349 0.42
350 0.48
351 0.55
352 0.63
353 0.71
354 0.8
355 0.85
356 0.86
357 0.89
358 0.91
359 0.92
360 0.92
361 0.92
362 0.88
363 0.89
364 0.83
365 0.77
366 0.76
367 0.67
368 0.57
369 0.49
370 0.43
371 0.4
372 0.35
373 0.32
374 0.26
375 0.27
376 0.25
377 0.24
378 0.23
379 0.17
380 0.17
381 0.17
382 0.14
383 0.14
384 0.15
385 0.16
386 0.16
387 0.14
388 0.14
389 0.14
390 0.17
391 0.16
392 0.15
393 0.14
394 0.14
395 0.16
396 0.19
397 0.2
398 0.17
399 0.17
400 0.17
401 0.18
402 0.17
403 0.16
404 0.14