Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NYV0

Protein Details
Accession J3NYV0    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
11-37ATVFLKHTNPKKRGWRRNRKSNLELAAHydrophilic
NLS Segment(s)
PositionSequence
20-30PKKRGWRRNRK
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MEVAEDVAVCATVFLKHTNPKKRGWRRNRKSNLELAAQHGRRWLQTGGTYLEIWAWRASSNSSRQAGNNQKPPAAAANEEAASPRAVQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.23
4 0.32
5 0.42
6 0.45
7 0.53
8 0.63
9 0.72
10 0.78
11 0.81
12 0.84
13 0.84
14 0.92
15 0.93
16 0.91
17 0.85
18 0.81
19 0.74
20 0.67
21 0.57
22 0.51
23 0.5
24 0.41
25 0.36
26 0.31
27 0.27
28 0.23
29 0.25
30 0.2
31 0.12
32 0.13
33 0.15
34 0.15
35 0.16
36 0.15
37 0.12
38 0.13
39 0.12
40 0.11
41 0.09
42 0.08
43 0.07
44 0.08
45 0.11
46 0.14
47 0.19
48 0.25
49 0.27
50 0.28
51 0.29
52 0.37
53 0.45
54 0.49
55 0.52
56 0.48
57 0.47
58 0.46
59 0.47
60 0.42
61 0.34
62 0.27
63 0.21
64 0.22
65 0.21
66 0.21
67 0.21
68 0.17
69 0.15