Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3VEF5

Protein Details
Accession A0A2D3VEF5   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
441-461SDSHRMRLPRRGPRAKKLTSFHydrophilic
569-591PLYWWRVGSKRGRKSEQNGSQKFHydrophilic
NLS Segment(s)
PositionSequence
449-457LPRRGPRAK
581-583GRK
595-599RWRRK
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR002293  AA/rel_permease1  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF13520  AA_permease_2  
Amino Acid Sequences MPSNPSRDSPARLLAPRDSLELGSLASSNDDGRNSIESSLSGTPSSRRLSSGGATPTRPTRGDRSYSVSSAFDFNSSLFPLSSSGPGYTSLGAPTTPGFDLGAQSLERNKSLTYLNGLSLVIGVVIGSGIFSSPASVNTNAGSPGAALIVWVISGILAWTGAASYAELGGAIPLNGGAQVYLSKIFGEWAGFLFTWCAVVVLKPGSAAIIAIIFGEYVVSAITGTDASGVSPWINKSVALLGLVLVTAINCVSTKLGTRSADFFMFLKFVALLGITVAGIVVAVTGMAYHKEALSQTWKTTPWFEGTSTSSSEWAVAIYAGLWAYDGWDNTNYVVGEMLHPSRDLPKVIHTAIPVVILAYILANLAYIFVLPTEIVNSSNTIAVAFGSTVLGRLGALILALAVAGSCFGALNASTFTAGRLVYSAGKEGYIPEIFGAVGLSDXSHRMRLPRRGPRAKKLTSFIADEQGFFYTPIYAMMLNAAITAIYVVIGDFTTLTTFYGVASYLFYFASVVGLIILRVKEPELDRPYKCWITTPIIFCCVSLFLLSRAIFAKPLQALVVLAFIAVGFPLYWWRVGSKRGRKSEQNGSQKFWNRWRRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.49
3 0.44
4 0.43
5 0.37
6 0.3
7 0.27
8 0.23
9 0.19
10 0.14
11 0.13
12 0.1
13 0.09
14 0.1
15 0.11
16 0.12
17 0.13
18 0.13
19 0.15
20 0.18
21 0.18
22 0.18
23 0.17
24 0.15
25 0.19
26 0.2
27 0.19
28 0.17
29 0.17
30 0.19
31 0.24
32 0.28
33 0.25
34 0.24
35 0.25
36 0.28
37 0.29
38 0.34
39 0.36
40 0.36
41 0.36
42 0.38
43 0.42
44 0.43
45 0.42
46 0.39
47 0.4
48 0.43
49 0.47
50 0.47
51 0.49
52 0.5
53 0.49
54 0.47
55 0.4
56 0.33
57 0.31
58 0.27
59 0.2
60 0.16
61 0.15
62 0.15
63 0.15
64 0.15
65 0.12
66 0.12
67 0.13
68 0.14
69 0.15
70 0.14
71 0.13
72 0.13
73 0.15
74 0.15
75 0.15
76 0.14
77 0.13
78 0.12
79 0.11
80 0.11
81 0.1
82 0.11
83 0.11
84 0.1
85 0.1
86 0.1
87 0.11
88 0.11
89 0.13
90 0.11
91 0.12
92 0.16
93 0.18
94 0.18
95 0.18
96 0.17
97 0.17
98 0.19
99 0.2
100 0.2
101 0.2
102 0.2
103 0.2
104 0.2
105 0.17
106 0.16
107 0.13
108 0.07
109 0.05
110 0.04
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.03
118 0.03
119 0.05
120 0.05
121 0.08
122 0.11
123 0.12
124 0.13
125 0.13
126 0.14
127 0.13
128 0.13
129 0.11
130 0.07
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.02
148 0.03
149 0.03
150 0.03
151 0.03
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.03
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.03
166 0.04
167 0.05
168 0.06
169 0.06
170 0.06
171 0.06
172 0.07
173 0.07
174 0.07
175 0.06
176 0.06
177 0.09
178 0.08
179 0.08
180 0.09
181 0.08
182 0.08
183 0.07
184 0.07
185 0.05
186 0.05
187 0.07
188 0.08
189 0.08
190 0.07
191 0.07
192 0.07
193 0.06
194 0.06
195 0.04
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.03
210 0.03
211 0.03
212 0.04
213 0.04
214 0.04
215 0.04
216 0.05
217 0.05
218 0.06
219 0.07
220 0.08
221 0.08
222 0.08
223 0.09
224 0.1
225 0.1
226 0.09
227 0.08
228 0.06
229 0.06
230 0.06
231 0.05
232 0.04
233 0.03
234 0.03
235 0.03
236 0.03
237 0.03
238 0.03
239 0.04
240 0.04
241 0.06
242 0.09
243 0.14
244 0.14
245 0.16
246 0.18
247 0.2
248 0.19
249 0.18
250 0.17
251 0.12
252 0.12
253 0.1
254 0.08
255 0.06
256 0.06
257 0.05
258 0.04
259 0.04
260 0.03
261 0.03
262 0.03
263 0.03
264 0.02
265 0.02
266 0.02
267 0.02
268 0.02
269 0.01
270 0.01
271 0.01
272 0.02
273 0.02
274 0.03
275 0.03
276 0.04
277 0.04
278 0.05
279 0.05
280 0.07
281 0.11
282 0.12
283 0.13
284 0.15
285 0.16
286 0.16
287 0.18
288 0.18
289 0.16
290 0.16
291 0.16
292 0.16
293 0.18
294 0.18
295 0.18
296 0.17
297 0.15
298 0.13
299 0.13
300 0.1
301 0.08
302 0.06
303 0.04
304 0.04
305 0.03
306 0.04
307 0.03
308 0.03
309 0.03
310 0.03
311 0.04
312 0.06
313 0.06
314 0.06
315 0.07
316 0.08
317 0.08
318 0.1
319 0.08
320 0.07
321 0.07
322 0.07
323 0.07
324 0.08
325 0.09
326 0.07
327 0.07
328 0.08
329 0.11
330 0.12
331 0.12
332 0.12
333 0.15
334 0.19
335 0.2
336 0.21
337 0.18
338 0.18
339 0.17
340 0.16
341 0.12
342 0.08
343 0.07
344 0.05
345 0.05
346 0.04
347 0.03
348 0.03
349 0.03
350 0.03
351 0.02
352 0.03
353 0.03
354 0.03
355 0.03
356 0.03
357 0.03
358 0.03
359 0.03
360 0.04
361 0.05
362 0.06
363 0.06
364 0.07
365 0.08
366 0.08
367 0.08
368 0.07
369 0.07
370 0.06
371 0.06
372 0.05
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.04
380 0.04
381 0.04
382 0.03
383 0.03
384 0.03
385 0.02
386 0.02
387 0.02
388 0.02
389 0.02
390 0.02
391 0.02
392 0.02
393 0.02
394 0.02
395 0.02
396 0.03
397 0.03
398 0.04
399 0.05
400 0.05
401 0.06
402 0.06
403 0.07
404 0.08
405 0.08
406 0.07
407 0.07
408 0.08
409 0.1
410 0.1
411 0.12
412 0.1
413 0.11
414 0.11
415 0.11
416 0.13
417 0.11
418 0.11
419 0.09
420 0.09
421 0.09
422 0.09
423 0.08
424 0.04
425 0.04
426 0.04
427 0.06
428 0.09
429 0.1
430 0.11
431 0.14
432 0.17
433 0.21
434 0.3
435 0.39
436 0.45
437 0.56
438 0.65
439 0.7
440 0.77
441 0.84
442 0.81
443 0.78
444 0.72
445 0.69
446 0.61
447 0.58
448 0.5
449 0.48
450 0.41
451 0.35
452 0.32
453 0.25
454 0.22
455 0.18
456 0.16
457 0.09
458 0.09
459 0.09
460 0.09
461 0.08
462 0.07
463 0.08
464 0.08
465 0.07
466 0.06
467 0.06
468 0.04
469 0.04
470 0.04
471 0.03
472 0.03
473 0.03
474 0.03
475 0.03
476 0.03
477 0.04
478 0.04
479 0.04
480 0.05
481 0.05
482 0.06
483 0.06
484 0.06
485 0.06
486 0.07
487 0.07
488 0.06
489 0.08
490 0.08
491 0.08
492 0.08
493 0.08
494 0.08
495 0.07
496 0.08
497 0.06
498 0.06
499 0.05
500 0.05
501 0.05
502 0.08
503 0.08
504 0.08
505 0.09
506 0.09
507 0.14
508 0.16
509 0.25
510 0.31
511 0.38
512 0.39
513 0.42
514 0.5
515 0.49
516 0.48
517 0.43
518 0.4
519 0.41
520 0.46
521 0.47
522 0.43
523 0.43
524 0.42
525 0.38
526 0.33
527 0.27
528 0.21
529 0.17
530 0.15
531 0.12
532 0.18
533 0.18
534 0.19
535 0.19
536 0.19
537 0.19
538 0.18
539 0.23
540 0.18
541 0.19
542 0.17
543 0.16
544 0.16
545 0.14
546 0.15
547 0.09
548 0.07
549 0.06
550 0.06
551 0.05
552 0.04
553 0.04
554 0.03
555 0.04
556 0.08
557 0.1
558 0.11
559 0.12
560 0.16
561 0.2
562 0.28
563 0.39
564 0.46
565 0.55
566 0.64
567 0.71
568 0.76
569 0.8
570 0.83
571 0.83
572 0.83
573 0.78
574 0.73
575 0.75
576 0.74
577 0.74
578 0.74