Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V9T8

Protein Details
Accession A0A2D3V9T8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
73-93LVMIRSNRKKALKKAQAAKAKHydrophilic
NLS Segment(s)
PositionSequence
79-93NRKKALKKAQAAKAK
Subcellular Location(s) plas 18, E.R. 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0016757  F:glycosyltransferase activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAANNLLDRLVGLAMLVVASAVFLYYSVWTLLMPFVDEKHPVQSLFPPRVWAIRIPVILILLGGAVVGSFLSLVMIRSNRKKALKKAQAAKAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.03
12 0.04
13 0.05
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.06
21 0.06
22 0.07
23 0.08
24 0.1
25 0.1
26 0.12
27 0.14
28 0.13
29 0.13
30 0.18
31 0.22
32 0.24
33 0.23
34 0.22
35 0.22
36 0.23
37 0.24
38 0.19
39 0.17
40 0.17
41 0.17
42 0.16
43 0.16
44 0.14
45 0.13
46 0.11
47 0.08
48 0.03
49 0.03
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.03
60 0.04
61 0.07
62 0.11
63 0.17
64 0.24
65 0.3
66 0.37
67 0.46
68 0.54
69 0.62
70 0.7
71 0.74
72 0.77
73 0.82