Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3V7S7

Protein Details
Accession A0A2D3V7S7    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
31-56VAKVVKLPKETTKKRKNSKILPLKTTHydrophilic
NLS Segment(s)
PositionSequence
12-49TKKGAAKKPATKPTVSKTSVAKVVKLPKETTKKRKNSK
Subcellular Location(s) mito 11, nucl 8, cyto 8, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MAWPTAEQRAATKKGAAKKPATKPTVSKTSVAKVVKLPKETTKKRKNSKILPLKTTVAEGKPTYRGEATLGSKKVRSSPTSQRISIDGLSYVLVXEHEHNPVDTAKRDALIVRLRELRNELFEDGNCDFTLAGKQIGIAIALLRDGGGEDEEDASDGDRFGGADNGQSDWVTLCELITSDSCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.54
3 0.56
4 0.57
5 0.62
6 0.71
7 0.75
8 0.73
9 0.68
10 0.66
11 0.67
12 0.68
13 0.6
14 0.54
15 0.48
16 0.49
17 0.53
18 0.48
19 0.42
20 0.38
21 0.45
22 0.47
23 0.47
24 0.45
25 0.46
26 0.56
27 0.64
28 0.68
29 0.69
30 0.74
31 0.8
32 0.87
33 0.88
34 0.87
35 0.88
36 0.88
37 0.84
38 0.79
39 0.73
40 0.65
41 0.55
42 0.48
43 0.4
44 0.3
45 0.27
46 0.23
47 0.21
48 0.23
49 0.23
50 0.22
51 0.2
52 0.19
53 0.17
54 0.21
55 0.23
56 0.24
57 0.26
58 0.25
59 0.26
60 0.26
61 0.3
62 0.29
63 0.28
64 0.28
65 0.37
66 0.45
67 0.48
68 0.48
69 0.44
70 0.41
71 0.4
72 0.34
73 0.24
74 0.15
75 0.1
76 0.1
77 0.09
78 0.07
79 0.05
80 0.05
81 0.05
82 0.06
83 0.07
84 0.07
85 0.07
86 0.08
87 0.09
88 0.11
89 0.11
90 0.12
91 0.11
92 0.11
93 0.12
94 0.11
95 0.15
96 0.19
97 0.19
98 0.2
99 0.26
100 0.26
101 0.27
102 0.3
103 0.26
104 0.24
105 0.25
106 0.23
107 0.18
108 0.18
109 0.21
110 0.18
111 0.18
112 0.16
113 0.14
114 0.12
115 0.11
116 0.13
117 0.1
118 0.09
119 0.08
120 0.08
121 0.08
122 0.08
123 0.08
124 0.06
125 0.05
126 0.05
127 0.05
128 0.05
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.05
136 0.06
137 0.06
138 0.07
139 0.07
140 0.07
141 0.07
142 0.07
143 0.06
144 0.06
145 0.06
146 0.06
147 0.09
148 0.08
149 0.11
150 0.12
151 0.13
152 0.14
153 0.14
154 0.13
155 0.11
156 0.12
157 0.1
158 0.09
159 0.08
160 0.07
161 0.08
162 0.1