Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3VCD3

Protein Details
Accession A0A2D3VCD3   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-125PEDAARVTEKQKKKQRHFPQRNFAVKVVHydrophilic
NLS Segment(s)
PositionSequence
91-98RAIRRRLS
104-114RVTEKQKKKQR
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAQALWGKNKDELQKQLDELKQELVQLRTQKIAGGAGSKLNKIHDVRKSIARVLTIINANQRSQLRLFYSGKKYMPXDLRPKQTRAIRRRLSPEDAARVTEKQKKKQRHFPQRNFAVKVVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.52
4 0.51
5 0.53
6 0.47
7 0.46
8 0.45
9 0.48
10 0.45
11 0.41
12 0.36
13 0.31
14 0.27
15 0.26
16 0.28
17 0.22
18 0.24
19 0.26
20 0.26
21 0.24
22 0.24
23 0.22
24 0.19
25 0.18
26 0.15
27 0.12
28 0.12
29 0.14
30 0.16
31 0.16
32 0.16
33 0.15
34 0.2
35 0.2
36 0.26
37 0.26
38 0.3
39 0.32
40 0.37
41 0.38
42 0.35
43 0.34
44 0.28
45 0.24
46 0.2
47 0.2
48 0.15
49 0.14
50 0.16
51 0.16
52 0.15
53 0.19
54 0.18
55 0.17
56 0.17
57 0.18
58 0.16
59 0.21
60 0.24
61 0.27
62 0.32
63 0.34
64 0.35
65 0.33
66 0.34
67 0.37
68 0.41
69 0.45
70 0.47
71 0.51
72 0.58
73 0.6
74 0.66
75 0.64
76 0.68
77 0.66
78 0.7
79 0.67
80 0.66
81 0.73
82 0.7
83 0.69
84 0.66
85 0.63
86 0.6
87 0.54
88 0.5
89 0.44
90 0.41
91 0.41
92 0.43
93 0.46
94 0.48
95 0.57
96 0.65
97 0.72
98 0.81
99 0.86
100 0.88
101 0.92
102 0.92
103 0.94
104 0.93
105 0.92
106 0.86