Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2D3UVL4

Protein Details
Accession A0A2D3UVL4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-124RQSPTMARKKEKRRVPKDQLALAHydrophilic
NLS Segment(s)
PositionSequence
110-117RKKEKRRV
Subcellular Location(s) nucl 13, mito 8, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038291  SAP30_C_sf  
Amino Acid Sequences MPXKATDTGATVRERQIAAAAHARSKKVANGNSHAQPAYHTGPMKELPPISNNAPAPPPTGMAWSIASSALLDTYRVAHNLPSPAAFTSPLRQALLTNSGIGRQSPTMARKKEKRRVPKDQLALAVRKNFNGAAVSEIDVVVELVYKVRNQDKKFRMRSTPGVTKKIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.23
4 0.24
5 0.28
6 0.27
7 0.29
8 0.32
9 0.32
10 0.31
11 0.31
12 0.33
13 0.34
14 0.39
15 0.4
16 0.43
17 0.48
18 0.5
19 0.51
20 0.45
21 0.37
22 0.32
23 0.31
24 0.28
25 0.25
26 0.23
27 0.2
28 0.23
29 0.24
30 0.24
31 0.21
32 0.2
33 0.17
34 0.18
35 0.22
36 0.2
37 0.25
38 0.25
39 0.23
40 0.24
41 0.22
42 0.23
43 0.19
44 0.19
45 0.13
46 0.15
47 0.13
48 0.13
49 0.13
50 0.11
51 0.11
52 0.09
53 0.09
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.04
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.1
66 0.11
67 0.11
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.1
75 0.12
76 0.13
77 0.13
78 0.13
79 0.13
80 0.14
81 0.17
82 0.15
83 0.13
84 0.12
85 0.12
86 0.13
87 0.12
88 0.12
89 0.08
90 0.09
91 0.12
92 0.19
93 0.26
94 0.31
95 0.39
96 0.47
97 0.57
98 0.65
99 0.7
100 0.75
101 0.77
102 0.83
103 0.85
104 0.85
105 0.81
106 0.75
107 0.73
108 0.66
109 0.6
110 0.53
111 0.5
112 0.42
113 0.35
114 0.33
115 0.26
116 0.23
117 0.21
118 0.18
119 0.12
120 0.13
121 0.14
122 0.13
123 0.12
124 0.11
125 0.09
126 0.09
127 0.06
128 0.05
129 0.04
130 0.05
131 0.07
132 0.08
133 0.12
134 0.21
135 0.29
136 0.33
137 0.44
138 0.53
139 0.62
140 0.71
141 0.74
142 0.74
143 0.73
144 0.78
145 0.77
146 0.79
147 0.76