Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3UR35

Protein Details
Accession A0A2D3UR35    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
92-117LSRLRTRTGRMILKRRRAKGRNTLSHHydrophilic
NLS Segment(s)
PositionSequence
85-112RKRRHGFLSRLRTRTGRMILKRRRAKGR
Subcellular Location(s) nucl 15.5, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MSLLTRCLTSLRPQLPLPTKTLSQRTFSALTTTSPLRPSILRPILPNSDLSSSSSSPSQQQLGSGSLIQLRGAKRDTFNPSHVVRKRRHGFLSRLRTRTGRMILKRRRAKGRNTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.49
4 0.45
5 0.4
6 0.41
7 0.43
8 0.51
9 0.45
10 0.41
11 0.4
12 0.41
13 0.39
14 0.36
15 0.32
16 0.24
17 0.22
18 0.22
19 0.22
20 0.19
21 0.18
22 0.18
23 0.17
24 0.17
25 0.19
26 0.25
27 0.28
28 0.28
29 0.28
30 0.32
31 0.33
32 0.33
33 0.31
34 0.23
35 0.2
36 0.19
37 0.19
38 0.18
39 0.15
40 0.16
41 0.15
42 0.14
43 0.14
44 0.15
45 0.14
46 0.11
47 0.11
48 0.12
49 0.12
50 0.12
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.11
57 0.1
58 0.12
59 0.15
60 0.16
61 0.17
62 0.23
63 0.29
64 0.29
65 0.31
66 0.34
67 0.35
68 0.43
69 0.47
70 0.49
71 0.46
72 0.53
73 0.57
74 0.59
75 0.63
76 0.61
77 0.64
78 0.67
79 0.74
80 0.72
81 0.68
82 0.65
83 0.6
84 0.57
85 0.56
86 0.54
87 0.52
88 0.52
89 0.6
90 0.67
91 0.75
92 0.81
93 0.82
94 0.85
95 0.82
96 0.83
97 0.83