Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJ18

Protein Details
Accession J3PJ18   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
39-61EMNKLMAKRKRKRTICSMYRKSIHydrophilic
NLS Segment(s)
PositionSequence
45-51AKRKRKR
Subcellular Location(s) nucl 19, mito_nucl 12.833, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000679  Znf_GATA  
IPR013088  Znf_NHR/GATA  
Gene Ontology GO:0043565  F:sequence-specific DNA binding  
GO:0008270  F:zinc ion binding  
GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MLQLWDNFHPLWWRDESGHTVYDACGLYWRLKSALRPAEMNKLMAKRKRKRTICSMYRKSIEKRQQMASTPTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.28
3 0.31
4 0.28
5 0.27
6 0.23
7 0.21
8 0.18
9 0.2
10 0.17
11 0.12
12 0.12
13 0.12
14 0.14
15 0.14
16 0.15
17 0.13
18 0.14
19 0.16
20 0.21
21 0.26
22 0.24
23 0.26
24 0.27
25 0.33
26 0.33
27 0.33
28 0.28
29 0.28
30 0.33
31 0.38
32 0.46
33 0.48
34 0.58
35 0.67
36 0.72
37 0.74
38 0.78
39 0.83
40 0.82
41 0.84
42 0.81
43 0.79
44 0.77
45 0.76
46 0.72
47 0.71
48 0.71
49 0.7
50 0.67
51 0.67
52 0.67
53 0.66