Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2D3V0E2

Protein Details
Accession A0A2D3V0E2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-33AKSKNSSQHNQAKKNHKNGIKKPKTNRYPSLKHydrophilic
NLS Segment(s)
PositionSequence
13-62AKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRXALHGTMKALKEVKEGKR
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNSSQHNQAKKNHKNGIKKPKTNRYPSLKGTDPKFRRNHRXALHGTMKALKEVKEGKRDAX
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.82
3 0.81
4 0.79
5 0.79
6 0.81
7 0.83
8 0.83
9 0.82
10 0.82
11 0.84
12 0.85
13 0.83
14 0.81
15 0.79
16 0.75
17 0.7
18 0.67
19 0.61
20 0.56
21 0.52
22 0.54
23 0.5
24 0.52
25 0.56
26 0.57
27 0.62
28 0.63
29 0.66
30 0.64
31 0.67
32 0.62
33 0.62
34 0.59
35 0.54
36 0.53
37 0.46
38 0.43
39 0.37
40 0.35
41 0.33
42 0.38
43 0.41