Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7XGH3

Protein Details
Accession A0A2B7XGH3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
267-297ELERRPRRSDMDQKRLRSRSPPSRRKRSRSRBasic
NLS Segment(s)
PositionSequence
251-297REKGKSPMGSGQSRRAELERRPRRSDMDQKRLRSRSPPSRRKRSRSR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012479  SAP30BP  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF07818  HCNGP  
Amino Acid Sequences MIGLAAYGSSSEDESPREPASNVKKPKAISPQSAQAQEQKAESPKVETSQEPAASIEDFSKPLVGPFQPGRSISPVNDAEKAPRDQSPFSTTRALIHDMTLPPIPSLDIPPSPPGSPNPAANQKFAHFLRLKKQGVHFNEKLASNSSLRNPSLLAKLMSHAGIGEQDQYASSFPTDLWDISALPEWGYKEELNKSQQDIRRKIEEKKTAGQRDAVDFVSGGVSGESSRGGTPSSGRGRASAAERVMAGLSREKGKSPMGSGQSRRAELERRPRRSDMDQKRLRSRSPPSRRKRSRSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.2
4 0.21
5 0.2
6 0.28
7 0.36
8 0.43
9 0.5
10 0.52
11 0.55
12 0.54
13 0.63
14 0.64
15 0.62
16 0.6
17 0.57
18 0.61
19 0.63
20 0.65
21 0.58
22 0.54
23 0.51
24 0.45
25 0.4
26 0.36
27 0.34
28 0.33
29 0.32
30 0.29
31 0.27
32 0.29
33 0.3
34 0.26
35 0.26
36 0.3
37 0.29
38 0.26
39 0.24
40 0.22
41 0.2
42 0.19
43 0.17
44 0.12
45 0.12
46 0.11
47 0.12
48 0.11
49 0.11
50 0.14
51 0.13
52 0.16
53 0.19
54 0.23
55 0.24
56 0.25
57 0.27
58 0.28
59 0.3
60 0.25
61 0.29
62 0.29
63 0.29
64 0.31
65 0.28
66 0.28
67 0.31
68 0.32
69 0.27
70 0.27
71 0.28
72 0.27
73 0.3
74 0.33
75 0.3
76 0.31
77 0.32
78 0.29
79 0.28
80 0.3
81 0.3
82 0.23
83 0.22
84 0.23
85 0.2
86 0.21
87 0.2
88 0.17
89 0.13
90 0.13
91 0.13
92 0.09
93 0.1
94 0.11
95 0.11
96 0.12
97 0.14
98 0.16
99 0.16
100 0.17
101 0.16
102 0.2
103 0.21
104 0.22
105 0.25
106 0.33
107 0.34
108 0.34
109 0.34
110 0.28
111 0.32
112 0.3
113 0.33
114 0.26
115 0.27
116 0.33
117 0.41
118 0.42
119 0.39
120 0.43
121 0.44
122 0.46
123 0.53
124 0.46
125 0.39
126 0.41
127 0.38
128 0.34
129 0.29
130 0.25
131 0.17
132 0.18
133 0.19
134 0.19
135 0.19
136 0.18
137 0.16
138 0.16
139 0.17
140 0.17
141 0.15
142 0.11
143 0.12
144 0.12
145 0.12
146 0.1
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.07
164 0.07
165 0.07
166 0.07
167 0.08
168 0.1
169 0.08
170 0.08
171 0.09
172 0.09
173 0.09
174 0.11
175 0.11
176 0.13
177 0.17
178 0.21
179 0.24
180 0.25
181 0.27
182 0.32
183 0.37
184 0.43
185 0.45
186 0.45
187 0.51
188 0.53
189 0.58
190 0.6
191 0.64
192 0.6
193 0.63
194 0.67
195 0.63
196 0.61
197 0.57
198 0.5
199 0.45
200 0.42
201 0.34
202 0.24
203 0.19
204 0.17
205 0.13
206 0.11
207 0.08
208 0.05
209 0.05
210 0.04
211 0.05
212 0.05
213 0.06
214 0.06
215 0.06
216 0.07
217 0.08
218 0.09
219 0.18
220 0.23
221 0.26
222 0.26
223 0.26
224 0.27
225 0.3
226 0.32
227 0.29
228 0.24
229 0.22
230 0.22
231 0.21
232 0.2
233 0.17
234 0.15
235 0.14
236 0.16
237 0.19
238 0.2
239 0.21
240 0.24
241 0.27
242 0.28
243 0.28
244 0.33
245 0.35
246 0.43
247 0.46
248 0.52
249 0.54
250 0.52
251 0.51
252 0.47
253 0.47
254 0.48
255 0.55
256 0.56
257 0.59
258 0.64
259 0.65
260 0.68
261 0.71
262 0.73
263 0.73
264 0.74
265 0.74
266 0.76
267 0.82
268 0.81
269 0.76
270 0.74
271 0.74
272 0.74
273 0.77
274 0.79
275 0.8
276 0.85
277 0.92