Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2B7Z2I0

Protein Details
Accession A0A2B7Z2I0    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
115-154TTNGEEKRGRGRPKKNDTGTAKTPAKAQKKTKTPTPRSMEHydrophilic
NLS Segment(s)
PositionSequence
102-167AKKQKKTAAAAAGTTNGEEKRGRGRPKKNDTGTAKTPAKAQKKTKTPTPRSMEGIGSRTRSRAKPS
Subcellular Location(s) nucl 18, cyto_nucl 14, cyto 8
Family & Domain DBs
Amino Acid Sequences MASESPVNGTVPAATDIVEKDEDTPTSTSDNPSEEPANGDVAMKNAYAEKPAAAGDKEEEEEPTTGSSKSTSDTKHERDESQNGSEEDEEKAPAAKDEEPAAKKQKKTAAAAAGTTNGEEKRGRGRPKKNDTGTAKTPAKAQKKTKTPTPRSMEGIGSRTRSRAKPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.14
5 0.14
6 0.13
7 0.13
8 0.15
9 0.15
10 0.17
11 0.17
12 0.15
13 0.18
14 0.19
15 0.19
16 0.19
17 0.21
18 0.2
19 0.22
20 0.22
21 0.19
22 0.21
23 0.19
24 0.18
25 0.16
26 0.15
27 0.12
28 0.12
29 0.13
30 0.1
31 0.09
32 0.1
33 0.1
34 0.1
35 0.1
36 0.09
37 0.09
38 0.1
39 0.11
40 0.1
41 0.1
42 0.1
43 0.11
44 0.12
45 0.11
46 0.11
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.09
53 0.09
54 0.09
55 0.08
56 0.1
57 0.13
58 0.13
59 0.18
60 0.25
61 0.28
62 0.34
63 0.35
64 0.36
65 0.36
66 0.4
67 0.37
68 0.33
69 0.32
70 0.26
71 0.25
72 0.22
73 0.19
74 0.16
75 0.13
76 0.11
77 0.08
78 0.08
79 0.07
80 0.08
81 0.09
82 0.09
83 0.09
84 0.12
85 0.17
86 0.18
87 0.22
88 0.31
89 0.34
90 0.35
91 0.39
92 0.43
93 0.42
94 0.44
95 0.46
96 0.43
97 0.39
98 0.39
99 0.35
100 0.3
101 0.24
102 0.21
103 0.17
104 0.11
105 0.12
106 0.11
107 0.12
108 0.19
109 0.27
110 0.37
111 0.44
112 0.55
113 0.63
114 0.73
115 0.82
116 0.78
117 0.8
118 0.78
119 0.76
120 0.71
121 0.7
122 0.63
123 0.53
124 0.55
125 0.54
126 0.56
127 0.57
128 0.62
129 0.62
130 0.69
131 0.74
132 0.78
133 0.8
134 0.8
135 0.81
136 0.79
137 0.75
138 0.7
139 0.67
140 0.63
141 0.57
142 0.53
143 0.48
144 0.45
145 0.41
146 0.4
147 0.44