Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PJ95

Protein Details
Accession J3PJ95   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-37VSNCLPASRSRPRRKPWNLSGESHydrophilic
NLS Segment(s)
PositionSequence
25-29RPRRK
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MAGDGGGRAGFSSKVSNCLPASRSRPRRKPWNLSGESAKALRTRPTRTAHLAHPRSRRCSVVLPPVIFAGLRSSTRHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.25
4 0.24
5 0.27
6 0.28
7 0.29
8 0.36
9 0.42
10 0.52
11 0.58
12 0.66
13 0.71
14 0.8
15 0.82
16 0.84
17 0.83
18 0.83
19 0.76
20 0.7
21 0.65
22 0.56
23 0.48
24 0.39
25 0.31
26 0.21
27 0.19
28 0.22
29 0.23
30 0.26
31 0.31
32 0.35
33 0.38
34 0.41
35 0.44
36 0.45
37 0.51
38 0.54
39 0.55
40 0.59
41 0.61
42 0.62
43 0.62
44 0.56
45 0.49
46 0.49
47 0.48
48 0.49
49 0.5
50 0.45
51 0.43
52 0.41
53 0.38
54 0.31
55 0.25
56 0.19
57 0.15
58 0.16